... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>21) - eco.soil.msu.ru/ )

... E-mail: Tchytannya@gmail.com Website of the Conference: www.tchytannya.org.ua Mailing address: National University "Law Academy of Ukraine named after Yaroslav Mudriy", Department of the Constitutional Law of Ukraine, organizing committee of The International Science Conference of Young Scientists, Researchers, Postgraduates and Students "Values of modern constitutionalism (V Todyka's readings)" Pushkinska street, 77, Kharkiv, 61024, Ukraine. ...

Еще в разделе: (Показать все результаты (>4) - www.law.msu.ru/ )

... Запятая между наречным придаточным предложением и главным предложением . Как правило, между наречным придаточным предложением и главным предложением ставится запятая, если наречное предложение предшествует главному: . If you think you can learn to write well without hard work, you are mistaken . ... Если наречное предложение короткое, то запятая может быть опущена. ... Чтобы избежать недоразумений, лучше всегда ставить запятую после наречного придаточного предложения, предшествующего главному. ...

Еще в разделе: (Показать все результаты (>114) - num-anal.srcc.msu.ru/ )

The Chair of Mathematical Theory of Intelligent Systems and . ... Staff . ... Gasanov Elyar Eldarovich was born on November 14, 1959, in Moscow. ... In Moscow State University, E.E. Gasanov lectures the special courses "Theory of intelligent systems", "Theory of databases and information retrieval", "Additional chapters of discrete mathematics and mathematical cybernetics" and holds a special seminar in problems of complexity of search algorithms. ... Gasanov E.E. Instantly solvable search problems. ...

Еще в разделе: (Показать все результаты (>93) - www.intsys.msu.ru/ )

• Game Rules
• Intelligent Systems :: Staff :: Nosov Valentin Alexandrovich :: History of
• Intelligent Systems :: Research :: :: Articles

Encapsulates I/O asynchronicity. More... #include < qasyncio.h > . ... The Qt classes for asynchronous input/output provide a simple mechanism to allow large files or slow datasources to be processed without using large amounts of memory, or blocking the user interface. ... Derived classes should call this when they change from being unready to ready. ... This file is part of the Qt toolkit , copyright 1995-98 Troll Tech , all rights reserved. ... qasyncio.h: 1998/07/03 . ...

Еще в разделе: (Показать все результаты (>657) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QMainWindow Class
• Qt Toolkit - dirview/dirview.cpp example file
• Qt Toolkit - layout/layout.cpp example file

... The Council on Complex Problems of Cosmic Rays of the Russian Academy of Sciences and the Skobeltsyn Institute of Nuclear Physics (SINP) of Lomonosov Moscow State University are planning to held a workshop "Cosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century" on May 16-18 2011 at the Moscow State University. ... The Workshop banquet will be held on Tuesday, May 17 th . ... Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century"...

Еще в разделе: (Показать все результаты (>7) - tunka.sinp.msu.ru/ )

DNS Security, Stability and Resiliency John Crain Chief Technical Officer April 21st 2009 Garmisch 1 Monday, 20 April 2009 Agenda · The Global DNS SSR Symposium · Problems and Opportunities · Questions? ... The level of awareness with respect to the DNS is very low" ­ All quotes from Symposium Report 7 Monday, 20 April 2009 Problems & Opportunities 8 Monday, 20 April 2009 Problem: · There is a need for training across all sectors of the industry to raise both skills and awareness. ...

Еще в разделе: (Показать все результаты (>16) - iisi.msu.ru/ )

... Научная работа . Научные направления . ... Научные статьи . ... Учебная работа . Абакумов Артем Михайлович . Говоров Виталий Александрович . ... Калужских Максим Сергеевич . Копнин Евгений Михайлович . Локшин Константин Александрович . ... Пширков Юлиан Сергеевич . ... Цирлин Александр Александрович . ... Чижов Павел Сергеевич . ... МГУ им. М.В. Ломоносова . Химический факультет МГУ . ... Дизайн: HTML5 UP ...

Еще в разделе: (Показать все результаты (>2) - www.icr.chem.msu.ru/ )

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>3280) - hist.msu.ru/ )

• The Founding of Moscow University
• Visual Images of Patriarch Nikon

Kluwer Academic Publishers, attn. Annelies Kersbergen, P.O. Box 17, 3300 AA Dordrecht, The Netherlands, Telephone: (0)78-6576215, Telefax (0)78-6576388 Consent to Publish & Transfer of Copyright | For the mutual benefit and protection of Authors and Publishers it is | ... written Consent to Publish and Transfer of Copyright before publication of the| Work. The signed Consent ensures | that the Publisher has the Author's permission to publish the relevant | Contribution. ...

Еще в разделе: (Показать все результаты (>125) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/ihss/pdf/10th%20nordic%20chapter.pdf
• http://www.mgumus.chem.msu.ru/arw/natocamera-ready.doc

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>1220) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta

The Department of Talented Youth Affairs and Professional Orientation . ... Projects . ... From 1 to 6 July 2014 there were held the third championship of the ?SanSat in Russia? which took place in Dubna (Moscow) ? ... CanSat is a model of microsatellite weighing about 350 grams. CanSat project started in 1999. ... Participants at the third championship were offered a large educational and excursion programs. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>50) - talant.msu.ru/ )

• editor | The Department of Talented Youth Affairs and Professional Orientation
• News | The Department of Talented Youth Affairs and Professional Orientation
• Our Graduate Will Represent Lomonosov Moscow State University during the

... International Laser Center and Faculty of Physics . M.V.Lomonosov Moscow State University . Moscow 119899 . ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>90) - qilab.phys.msu.ru/ )

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>15) - www.ecocoop.ru/ )

• For three and half years of activity the participants of Ecological Cooperation

... Authors: Jose M. Madiedo et al. arxiv:1402.2644 Вращающаяся пара сверхмассивных черных дыр выявлена по данным VLBI наблюдений джетов S5 1928+738 (A spinning supermassive black hole binary revealed by VLBI data on the jet of S5 1928+738) . ... обзор arxiv:1402.0867 Большие вопросы в звездообразовании: темп звездообразования, звездные скопления и начальная функция масс (The Big Problems in Star Formation: the Star Formation Rate, Stellar Clustering, and the Initial Mass Function) . ...

Еще в разделе: (Показать все результаты (>478) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/1101.html
• http://xray.sai.msu.ru/~polar/sci_rev/0312.html
• http://xray.sai.msu.ru/~polar/sci_rev/0311.html

... line source . ... 6 def __init__ ( self , * args , ** kw ): . ... init__ ( self , * args , ** kw ) . ... 12 def attach ( self , widget ): . ... 15 widget [ command ] = lambda * args , ** kw : self . ... 17 def _command ( self , * args , ** kw ): . ... 24 def _set ( self , sender , * args , ** kw ): . ... 41 def tag_clear ( self , tag ): . ... 47 def insert ( self , * args , ** kw ): . ... insert ( self , * args , ** kw ) . ... 53 def _select ( self , ev ): . ... 79 names . ... 80 sequences . ...

Еще в разделе: (Показать все результаты (>6921) - kodomo.fbb.msu.ru/ )

• allpy: ab9e2260a60a sandbox/ttk.py
• allpy: f634a7d3943f README.devel
• allpy: README.devel annotate

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>73) - srcc.msu.ru/ )

• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of
• D.Moss, R.Stepanov, T.G.Arshakian, R. Beck, M.Krause, D.Sokoloff, Multiscale

. Yu.A.Shokin . Accurate positions of variable stars in the western part of the Large Magellanic Cloud bar . (published in IBVS and SAI Proceedings ) . B.S.Vozdvijenski, N.P.Gorbatko, V.A.Yeliseev, G.V.Romanova . The results of the observations of the selected minor planets in Sternberg State Astronomical institute . (published in SAI Proceedings ) .

Еще в разделе: (Показать все результаты (>14) - astrometric.sai.msu.ru/ )

• AMT articles
• Scientific Literature

Arthropoda Selecta 11 (3): 173175 ї ARTHROPODA SELECTA, 2002 Arietellus acutus a new species of Copepoda (Calanoida: Arietellidae) from the southwestern Indian Ocean Arietellus acutus, новый вид копепод (Calanoida: Arietellidae) из юго-западной части Индийского океана Athea K. Heinrich А.К. Гейнрих P.P. Shirshov Institute of Oceanology, Russian Academy of Sciences, Moscow 117851 Russia. ... New species Arietellus acutus is described below. segmented, terminal spines of Exp segment 3 of various length. ...

Еще в разделе: (Показать все результаты (>1315) - zmmu.msu.ru/ )

• http://zmmu.msu.ru/files/images/spec/journals/17_1%20101_103%20Tanasevitch.pdf
• Наши поездки
• Tropical centre

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>44) - cdfe.sinp.msu.ru/ )

• CDFE => Online services => Chart of Nuclear Quadrupole Deformations