... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>45) - rswater.phys.msu.ru/ )

... Geography of World Economy . ... Cryolithology and Glaciology . ... Departments . ... Research laboratories . ... Field stations . ... Type of field courses . ... Department of Cryolithology and Glaciology The Department was founded in 1945 with the name Department of northern countries . ... Our students are active members of PYRN (Permafrost Young Researchers Network), in which they share best practices, information about conferences, field courses, jobs. ... ISBN 5-89176-095-9 . ...

Еще в разделе: (Показать все результаты (>67) - eng.geogr.msu.ru/ )

• International cooperation
• Publications

Russian . Selected publications of V. Zakharov 2015 . Zakharov V.S., Perchuk A.L., Zavyalov S.P., Sineva T.A., Gerya T.V. Supercomputer Simulation of Continental Collisions in Precambrian: The Effect of Lithosphere Thickness // Moscow University Geology Bulletin. ... P. 77–83. doi: 10.3103/S014587521502012X. Paper (pdf) . ... Paper (pdf) . ... Summary in English . ... DOI: 10.3103/S014587521101011X. Paper (pdf) . ... Paper (pdf) Summary in English . ... Page design: ©V.Zakharov . ...

Еще в разделе: (Показать все результаты (>28) - dynamo.geol.msu.ru/ )

... THEORETICAL PRINCIPLES AND METHODS OF REMEDIATION OF SOILS POLLUTED WITH HEAVY METALS . Galina Koptsik . ... Development of current principles and approaches for soil remediation in heavy metal polluted areas. ... The project aims to study and develop, both theoretically and experimentally, the current approaches to remediation of soils polluted with heavy metals. ... Potentialities and constraints of different approaches for remediation of heavy metal polluted soils will be analysed. ...

Еще в разделе: (Показать все результаты (>22) - eco.soil.msu.ru/ )

sparallel.ru . Older posts . Newer posts . Posted by admin . Continue reading . Posted in Разное . Мар 02 . ... свой бизнеси извлекать из него прибыль таким образом, чтобы те, с кем вы сотрудничаете, также могли расти и купить катерпиллер обувь интернет магазин изучать законы и принципы менеджмента, правила и процедуры фирмы обувь интернет магазин без регистрации прилагать усилия, чтобы следовать им на словах и зимние camel выполнять обязательства, взятые на ... Разное . ...

Еще в разделе: (Показать все результаты (>16) - sparallel.ru/ )

• sparallel.ru - Part 170
• admin | sparallel.ru - Part 24
• sparallel.ru - Part 23

... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>11) - lab106.imec.msu.ru/ )

PHP Manual . ... If the remote client disconnects the ABORTED state flag is turned on. ... With a shutdown function, when the remote user hits his STOP button, the next time your script tries to output something PHP will detect that the connection has been aborted and the shutdown function is called. This shutdown function will also get called at the end of your script terminating normally, so to do something different in case of a client diconnect you can use the connection_aborted() function. ...

Еще в разделе: (Показать все результаты (>354) - oit.cmc.msu.ru/ )

• fbsql_change_user
• mysql_change_user
• set_magic_quotes_runtime

Correction of solar dopplergrams' large-scale flatfield" . Patrickeyev I.A., Mashnich G.P., Khlystova A.I., Zhang H. The authors have proposed and compared three different methods of large-scale flatfield correction (time averaging, Fourier filtering, and wavelet-based filtering). ... Patrickeyev I.A. - Institute of Continuum Mechanics, Russian Academy of Sciences, Korolyova 1, 614013, Perm, Russia; e-mail: pat@icmm.ru . ...

Еще в разделе: (Показать все результаты (>130) - num-meth.srcc.msu.ru/ )

• "The SOL docking package for computer-aided drug design"
• "Scaling applications with irregular memory access on Blue Gene/P and Lomonosov
• "Quantum-chemical modeling of excited states of Bismuth monocations"

... О физическом факультете . ... Физический факультет . ... История факультета . ... Журнал "Ученые записки физич. факультета МГУ" . ... Журнал "Ученые записки физического факультета МГУ" . ... Серия "Выдающиеся ученые физического факультета МГУ" . ... М.: Физический факультет МГУ им. М.В.Ломоносова . ... под редакцией К.В.Показеева -- М.: Физический факультет МГУ, 2015, 376 с. Г.А.Сарданашвили . ... М.: Физический факультет МГУ . ... Константин Петрович Белов" (Серия: Выдающиеся ученые физического . ...

Еще в разделе: (Показать все результаты (>155) - phys.msu.ru/ )

• Задачи вступительных экзаменов

... Полная версия этой страницы: объявление о позиции постдока в университете Бристоля . Студенческий форум Физфака МГУ > Наука физика > Другое . ... Subject: [soft-matter] POSTDOCTORAL RESEARCH FELLOW ON THE THEORETICAL PHYSICS OF SOFT ACTIVE MATTER . ... POSTDOCTORAL RESEARCH FELLOW ON THE THEORETICAL PHYSICS OF SOFT ACTIVE MATTER . ... Active materials are a new class of soft materials maintained out of equilibrium by internal energy sources. ...

Еще в разделе: (Показать все результаты (>474) - wasp.phys.msu.ru/ )

• объявление о позиции постдока в университете Бристоля - Студенческий форум
• Студенческий форум Физфака МГУ > Системный администратор. Удаленная работа.
• Студенческий форум Физфака МГУ > Работа на лето (с возможным продолжением)

Aleksanteri Institute Visiting Scholars Programme Aleksanteri Visiting Fellowships 2013 ­2014 THE FELLOWSHIP Is intended for scholars who hold a PhD degree in a field relevant to the Aleksanteri Institute 's research agenda and whose place of residence i s outside of Finland Is for a period of two to three months between August 2013 and June 2014 Involves a research stay at the Aleksanteri ... An electronic application form 2. ... The applications are evaluated by three experts. ...

Еще в разделе: (Показать все результаты (>533) - www.mgubs.ru/ )

• http://www.mgubs.ru/images/Image/Aleksanteri_Visiting_Fellowships_2011-2012.pdf
• http://www.mgubs.ru/images/Image/CallforApplications22Apr09.txt

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>38) - observ.pereplet.ru/ )

Administration of the Smolensk Region Smolensk University for Humanities Russian Association of Geomorphologists GEOMORPHIC PROCESSES AND GEOARCHAEOLOGY From Landscape Archaeology to Archaeotourism August 27-31, 2012 Moscow- Smolensk , Russia First Circular SCIENTIFIC PROGRAM SUPPORT Moscow St at e University International Association of Geomorphologists St at e Historical Conference venue: Smolensk University for Humanities (SHU) www.shu.ru. ...

Еще в разделе: (Показать все результаты (>294) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/structure/labs/geos/personal/belova/Belova_IPY-2012_Abstract_01519.pdf
• http://www.geogr.msu.ru/structure/labs/geos/personal/velikotskiy/Velikotskiy%20Marakhtanov%20TICOP%20Vol%202.pdf
• CONTENT 2а(7)а2014

Список сообщений на конференциях. ... Gallyamov M.O., Kiselyova O.I ., Tuzov I., Ivanov Yu.D., Yaminsky I.V., . ... Uvarov V.Y., Romanov A.N., Gallyaov M.O., Kiselyova O.I., Yaminsky I.V., . ... Ivanov Yu.D., Uvarov V.Y., Romanov A.N., Gallyaov M.O., Kiselyova O.I., Yaminsky I.V., . ... Gallyamov M.O., Ivanov Y.D., Kiselyova O.I., Uvarov V.Y., Yaminsky I.V., . ... Yu.D. Ivanov , S.A. Usanov, O.I. Kiselyova, I.V. Yaminsky, V.A. Bykov, A.I. Archakov, . ... Kiselyova O.I., Frolova O.Yu., ...

Еще в разделе: (Показать все результаты (>118) - www.spm.genebee.msu.ru/ )

• Alexander S. Filonov Professional Publications
• Dealing with Exchange Buffer
• Ordering Windows

THE POST-SIMPOSIUM EXCURSION ( July 31 - August 7,1998 ) . ... The six-day excursion took the participants from Lanzhou via the western loess hill country to the north-eastern Tibetan Plateau and via the West Quinling Mountains back to Lanzhou. ... This section is 39m thick and contains the loess of the last glacial period as well as a basal complex of flood loam. In the latter, three poorly developed Ah-horizons can be identified. ...

Еще в разделе: (Показать все результаты (>182) - www.fadr.msu.ru/ )

• Report from the Secretary
• the paleopedology working group had a conference last year in Mexico on "Global
• Untitled

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>167) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• List of Publications
• A.N. Belozersky Institute of physico-chemical biology MSU

... Russian: ps 2 pages . Published in: Russian Math. Surveys 57 (2002), no.3. ... English: ps (gzipped) 41 pages . ... Finitely presented groups and semigroups in knot theory. Russian: ps (gzipped) tex . English: ps (gzipped) tex . ... Russian: ps (gzipped) English: ps 20 pages . arXiv.org e-Print archive: http://arXiv.org/abs/math.RA/0205042 . ... Russian: ps English: ps 11 pages . ... In this paper we introduce and study gauge-equivariant $K$-theory groups $K_\GR^i(Y)$. ...

Еще в разделе: (Показать все результаты (>174) - higeom.math.msu.su/ )

• Publications (Russian)
• C*-algebras and elliptic theory
• Alexey Garber

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . ... Selectivity interaction semiconductor nanocrystalline oxide gases : catalytic role of clusters . The project aims to develop methods to improve the specificity of the interaction of nanocrystalline oxide semiconductor SnO 2 , ZnO, In 2 O 3 gases to create selective gas sensors. ... 2008-2014 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>55) - www.lssm.inorg.chem.msu.ru/ )

• The Laboratory of chemistry and physics of sensor and semiconductor materials

... 2013 . ... Publications . ... Number of publications 0 . ... 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 . ... Publication type . ... Borisov A. V. , Kozlov V. V. , Mamaev I. S. Proceedings of the IUTAM Symposium on Hamiltonian Dynamics, Vortex Structures, Turbulence (Moscow August 25-30, 2006) . Dordrecht Springer, 2006, 512 . ... Institute of Computer Science Izhevsk, 2005 - 2016 . ...

Еще в разделе: (Показать все результаты (>210) - ics.org.ru/ )

... People . ... Photogallery: Chirinda, Evenkia, July-August 2007 . ... A house where people live . ... Valentina Khristoforovna Yoldogir . ... Audio recording the Evenki word list: the young people are working (Yulia Kombagir and Ilia Yoldogir, Ilia’s brother Misha listening) . ... Valentina Khristoforovna Yoldogir watching the video recording of her telling an Evenki fairy tale . ... Valentina Khristoforovna Yoldogir is telling an Evenki fairy tale to us and to her grandchildren sitting in the tent ....

Еще в разделе: (Показать все результаты (>67) - lcl.srcc.msu.ru/ )