... 2013-03-19 02:34 . ... index.htm . ... 1.1M . ...

Еще в разделе: (Показать все результаты (>390) - herba.msu.ru/ )

• Systema Naturae
• Index of /shipunov/school/biol_154/textbook/pics
• Описание экскурсии на гору Малая Куртяжная.

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>102) - neptun.sai.msu.ru/ )

• Manual Page: ab - Apache HTTP Server
• Manual Page: rotatelogs - Apache HTTP Server
• Apache module mod_negotiation

... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

... Interaction classes . Families of interaction class . Classes of protein-DNA interaction of SCOP families . ... Pfam families . SCOP families . ... Interaction modes . ... Interaction class . Class: H - Bb . Description : Conserved protein-DNA contacts are provided by helix(es) ( H ) with DNA backbone atoms ( Bb ). ... SCOP Domain Family . ... MnG depth . ... тАУ . ... All SCOP domain families with determined protein-DNA interaction classes . NPIDB team 2003 - 2016 . ...

Еще в разделе: (Показать все результаты (>101) - npidb.belozersky.msu.ru/ )

• NPIDB: List of complexes
• NPIDB: Home

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>75) - sai.msu.ru/ )

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>49) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

... News . ... The major part of the course is dedicated to the studying measuring devices and units for data collection and processing, re-engineering of unknown circuits. ... Programming an unknown board on TestVue Software . ... Functional testing of an unknown board; comparison with the pattern . ... Working on a course project: testing of a board or a device with unknown malfunctioning, faultfinding and debugging, demonstration of the functioning device. ... 2013-2015 Engineering Physics Laboratory...

Еще в разделе: (Показать все результаты (>20) - engineering.phys.msu.ru/ )

• Parallel Programming
• Introduction to Linux
• Noise Meter

... Acoustic Nonlinearity, Attenuation and Scattering of a Sound in Water with Vapor-Gas Bubbles . ... Nonlinear effects, attenuation and scattering of a sound, originated in propagating of a sound in a liquid with vapor-gas bubbles, are investigated. A liquid with phase inclusions near to phase transition represents an example of complex media, when at determination of the acoustic characteristics it should take into account phase transformations. ...

Еще в разделе: (Показать все результаты (>93) - acs366.phys.msu.su/ )

. Name . Last modified . Size . Description . Parent Directory . - . next.gif . 19-Jan-2010 19:54 . 116 . prev.gif . 19-Jan-2010 19:54 . 116 . rtop.gif . 19-Jan-2010 19:54 . 896 . Apache/2.2.16 (Debian) Server at www.kosmofizika.ru Port 80

Еще в разделе: (Показать все результаты (>197) - www.kosmofizika.ru/ )

• Index of /sinp/panasyuk/cr18_files
• Index of /sinp/panasyuk/cr11_files
• Index of /sinp/panasyuk/cr13_files

... Eals70@mail.ru , , , , - , Summary. ... The phonetic analysis of some lexical units of the text of the novel of F. M. Dostoevsky лDemonsЁ Has shown that some keywords of the novel, possessing a similar sound complex, approaches at associative level that leads to creation in product of special fonetiko-associative sense. ... The presentation focuses on the problems of rhyme description of 18th-century Russian poetry that appear in the process of work on Lomonosov's Rhyme Dictionary. л . ... XVIII Ё, ...

Еще в разделе: (Показать все результаты (>261) - www.philol.msu.ru/ )

• FDSL-7.5 | Home
• FDSL-7.5 | Call for Papers
• LangueDOC :: Archi :: Alphabet

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>51) - www.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... Standard MP4 benchmark . ... Press to visit Firefly version 8.0.0 beta Intel AVX-enabled Core i7 2600K benchmarks page . ... Press to visit PC GAMESS/Firefly version 7.1.F Core i7 940 benchmarks page (Windows 64-bit, HTT and Turbo Boost Technology enabled) . Press to visit PC GAMESS/Firefly version 7.1.E Core i7 benchmarks page (Linux 64-bit, HTT and Turbo Boost Technology disabled) . Press to visit PC GAMESS/Firefly version 7.1.E Core 2 Quadro Q9550 (Yorkfield) benchmarks page . ...

Еще в разделе: (Показать все результаты (>88) - classic.chem.msu.su/ )

• Preliminary PC GAMESS benchmarks on Quad-core Xeon (Clovertown)-based system
• Two years later: Firefly version 8.0.0 beta benchmarks on Intel Core i7 2600K
• Not kidding at all: PC GAMESS/Firefly v. 7.1.E benchmarks on Intel Core

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1228) - swx.sinp.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>61) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

T he student body is the central group of the Faculty of Physics. ... The Faculty offers its students the widest choice of training programmes and majoring opportunities. ... C urrently there are about 40 general courses and over 650 specialized courses delivered covering a wide range of traditional and new areas of physics research. ... F rom the first year students can be trained under two programs physics or astronomy. ... T here is a specific education system in place at the Faculty of Physics. ...

Еще в разделе: (Показать все результаты (>15) - foroff.phys.msu.ru/ )

Diploma thesis abstract "Pulse Terahertz Spectroscopy of complex Molecules" Smirnova I. N. Some of the vibration frequencies of molecular crystals lie in terahertz range. ... In present work the technique of pulse terahertz spectroscopy is used, to obtain absorption spectra in farinfrared region 10-110 cm-1. The influence of molecular and crystal structure on absorption spectra of molecular crystals is investigated by the example of some amino acids and polypeptides. ...

Еще в разделе: (Показать все результаты (>60) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2009/Krylova_Paraschuk_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2012/Mankova_Chikishev_Shkurinov_en.pdf
• Laboratory of nonlinear polarization optics

MSU . Science Park . ... Venue & Space . ... At Moscow State University Science Park, the laboratory and administrative offices are available to hire by innovative companies on a long or short term basis. ... MSU Science Park is situated in a picturesque area of Moscow, close to the MSU Botanical Garden on Sparrow Hills. With eight, two-storey buildings of 500 m 2 each on the site plus a four-storey building with an area of 7,500 m 2 , there is a total building area of 11,500 m 2 . ...

Еще в разделе: (Показать все результаты (>6) - www.sciencepark.ru/ )

• MSU Science Park - About us

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>5) - tex.bog.msu.ru/ )