... Conference Fee . ... Information . ... If you have already registered, please fill in you login and password in the form below main menu (leftmost column). If something goes wrong (for example, you've been registered by site andministrator and don't have password at all or you just forgot it), please contact site administration by E-mail mce@mce.su . If you are unsure if your personal data is present in our database, enter you first and last (family) name in the form below and press Register . ...

Еще в разделе: (Показать все результаты (>160) - www.mce.biophys.msu.ru/ )

... ---------- THE CONTRACTED PRIMITIVE FUNCTIONS HAVE BEEN UNNORMALIZED THE CONTRACTED BASIS FUNCTIONS ARE NOW NORMALIZED TO UNITY SHELL TYPE PRIM EXPONENT CONTRACTION COEFFICIENTS O 1 S 1 61420.000000 0.252311 ( 0.000090) 1 S 2 9199.000000 0.471110 ( 0.000698) 1 S 3 2091 ... -1.963764 ( -0.082992) 2 S 17 11.100000 -1.849206 ( -0.152090) 2 S 18 4.682000 -0.733942 ( -0.115331) 3 S 19 1.428000 0.931014 ( 1.000000 ) 4 S 20 0.554700 0.458093 ( 1.000000 ) 5 S 21 0.206700 0.218482 ( ...

Еще в разделе: (Показать все результаты (>69) - classic.chem.msu.su/ )

• WinGamess output file, Athlon XP 1500+/Bench 4
• WinGamess output file, Opteron 144/Bench 4
• WinGamess output file, Pentium 4/Bench 4

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• User's guide
• Input Formats

Field data, presented on fig. 11 were measured in town N (Samara region) at the study of oil pollution from refinery. ... Lower picture shows the rest or geological noise canceled with processing. 1D data interpretation gave traces of oil polluted zone in limestone as objects of low resistivity (fig.12) . Fig. ... Oil polluted zones (black) in limestone on 1D VES data interpretation 119899, Russia, Moscow, Moscow State University, Geological Faculty, Department of Geophysics . ...

Еще в разделе: (Показать все результаты (>65) - geophys.geol.msu.ru/ )

• TES tecnology. MSU.
• TES. Modeling example.

Homotopy types of moment-angle complexes based on joint work with Jelena Grbic, Stephen Theriault and Jie Wu Taras Panov Lomonosov Moscow State University The 39th Symposium on Transformation Groups Tokyo University of Science, Japan, 23ґ25 November 2012 Taras Panov (MSU) Homotopy typ es of m-a complexes Tokyo 24 Nov 2012 1 / 15 1. ... Taras Panov (MSU) Homotopy typ es of m-a complexes Tokyo 24 Nov 2012 2 / 15 2. ... The number of commutators of length Taras Panov (MSU) is equal to ( - 1) . ...

Еще в разделе: (Показать все результаты (>146) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/people/taras/talks/2008manchester-talk.pdf

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... While camera can be found in PC systems in increasing frequency, possibility of interaction between human and computer via visual face tracking seems to be very enticing. We introduce a novel hands free HCI system that enables to navigate mouse cursor through head movements. ... Two modes of mouse control are provided in the system: position based (Direct mode) and speed based (Joystick mode). ...

Еще в разделе: (Показать все результаты (>329) - graphics.cs.msu.ru/ )

• Mouse Control via User's Head Movements | Лаборатория компьютерной графики и
• Automatic Binary Segmentation of Moving Objects in Video | Graphics and Media
• Removing of blocking effect from video | Лаборатория компьютерной графики и

Space Weather Research in China and Introduction of CSSAR J. Cao (E-mail: jbcao@center.cssar.ac.cn) 1. ... Some important parameters of space environment are obtained, such as high energy charged particles (electrons, protons and heavy ions), single event upset, radiation dose, space plasma, surface charging, deep dielectric charging, upper atmosphere density and components, solar electromagnetic radiation and etc. ... The particle detectors soon detected the solar high energy particle fluxes. ...

Еще в разделе: (Показать все результаты (>6) - dbserv.sinp.msu.ru/ )

... 2.9 Using a pre-computed guide tree . ... 3 File Formats . ... With challenging sets of sequences, it is a good idea to make several different alignments using different muscle options and to try other programs too. ... You can ask muscle to try to improve an existing alignment by using the ? refine option. ... If you have two existing alignments of related sequences you can use the ?profile option of MUSCLE to align those two sequences. ... MUSCLE uses FASTA format for both input and output. ...

Еще в разделе: (Показать все результаты (>135) - www.genebee.msu.ru/ )

• BLAST Reference Manual Pages
• GeneBee
• GeneBee BLAST 2.2.22+ Services Help

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>25) - observ.pereplet.ru/ )

... In studies such as those of Dziewonski [1984 ], Woodhouse and Dziewonski [1984 ] or Tanimoto [1990 ] it was assumed a priori that the lateral variations in the structure could be represented by a spherical harmonic expansion truncated at some low degree such as 6 or 8. ... A very similar spectrum (up do degree 8) is obtained by predicting the SS data from 3-D models such as an upper mantle model M84C [ Woodhouse and Dziewonski, 1984 ]. ... U.S. National Report to IUGG, 1991-1994 . ...

Еще в разделе: (Показать все результаты (>574) - geo.web.ru/ )

• Петромагнетизм континентальной литосферы и природа региональных магнитных

О лаборатории . ... Лаборатория теоретической биофизики . ... The script generates nanotubes of arbitrary structure. ... To use it, save script to some file, then load into PyMol with the command: run /path/to/script.py . ... Here comes the script : # Nanotubes generating script for PyMol by piton at erg .biophys.msu.ru import cmd from math import cos,sin,pi,ceil,floor, acos from chempy import models, cpv class cell: def __init__(self ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>28) - erg.biophys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>15) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt
• Nhunt: program for nucleic acid sequence similarity search

Intelў Fortran Compiler Options Quick Reference Guide for Linux* Systems Legal Information Copyright ? 2003 Intel Corporation Document Number: 253258-001 i Intelў Fortran Compiler Options Quick Reference Disclaimer and Legal Information Information in this document is provided in connection with Intel products. No license, express or implied, by estoppel or otherwise, to any intellectual property rights is granted by this document. EXCEPT AS PROVIDED IN INTEL'S TERMS AND CONDITIONS OF SALE FOR SUCH

Еще в разделе: (Показать все результаты (>15) - www.arcetri.astro.it/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>1083) - zmmu.msu.ru/ )

... Phys. A25 (2010) 3933 (arXiv:0908.0457 [hep-ph]) A brief reminder AdS/CFT correspondence ґ the conjectured equivalence between a string theory defined on one space and a CFT without gravity defined on conformal boundary of this space. ... At one imposes certain gauge invariant boundary conditions on the fields. Equation of motion for the scalar field Solution independent of usual 4 space-time coordinates where M is identified with the quark mass matrix and with the condensate. ...

Еще в разделе: (Показать все результаты (>125) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2013/QFTHEP_Novikov.pdf
• http://qfthep.sinp.msu.ru/talks2015/Qfthep_mTCA_PVolkov.pdf
• http://qfthep.sinp.msu.ru/talks2015/1435604204_gladilin_talk.pdf

... Mathematical Treatment of Exhaust Systems with Acoustic Properties Using Mathlie I. Algorithms . ... The first part of the two talks is concerned with ? algorithms applied to examples origin from an ? exhaust system. ... The model equations are determined ? by conservation of mass, momentum and energy. In addition there exists an equation of state ? for the ideal gas system. ... Applying computer algebra to ? these model equations, we demonstrate that ? solutions can be derived. ...

Еще в разделе: (Показать все результаты (>103) - acs366.phys.msu.su/ )

• Abstract (Invited)

... Data . ... Models . ... Paraboloid model represents the magnetic fields in the Earth's magnetosphere as a superposition of the ring current B r , of the tail current including the closure currents on the magnetopause B t , of the Region 1 field-aligned currents B fac , of the magnetopause currents screening the dipole field B sd and of the magnetopause currents screening the ring current B sr : . ... the ring current magnetic field at the Earth's center b r ; . ... Magnetic field at MD outer edge . ...

Еще в разделе: (Показать все результаты (>16) - smdc.sinp.msu.ru/ )

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>116) - vestnik.math.msu.su/ )