RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>12) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.su/~yurin/Doxyfile
• Imaging lab: people

The revision of the MASS/DIMM star catalogue N. Shatsky, V. Kornilov March 16, 2008 Abstract The compilation of the (updated) version of the MASS (MASS/DIMM) device target catalogue is described. ... Then the list was cleaned according to following criteria: I. Remove stars too faint for a MASS device. ... Here the color equation of the Sternb erg device was taken: M AS S mag = V mag + 0.45 (B - V ); stars with M AS S mag > 3.2 were removed. ... This was made based on the GCVS4.2 catalogue data. ...

Еще в разделе: (Показать все результаты (>30) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/dimm_soft_description.pdf
• Index of /pub/
• Index of /pub/mirror/

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>138) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPsite - Algorithm Format requirements
• SDPsite - PF07978

CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...

Еще в разделе: (Показать все результаты (>14) - astrometric.sai.msu.ru/ )

• Specification

... Game field . This field contains mosaic cells that tha User shold move to play the game . Indicators . These indicators (video spectrum and sound volume) become active when the microphone is turned on. ... Distances to patterns . Distances from the said phrase to patterns of speech commands are shown in these boxes. ... The color of a box (from white to black) corresponds to a distance value (the lighter the box the smaller the distance) . Buttons . See Buttons help topic . ...

Еще в разделе: (Показать все результаты (>63) - www.intsys.msu.ru/ )

• Options
• Installation

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

О лаборатории . ... Лаборатория теоретической биофизики . ... This python script is capable of generating a set of GAMESS input files for potential energy surface scanning. ... Main script ?pes-scan.py? #!/usr/bin/python #################################### # Potential energy surface scanner # # by piton at erg .biophys.msu.ru # #################################### import os, sys, string, re, copy, threading, xml.dom.minidom from stat import ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>40) - erg.biophys.msu.ru/ )

• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: /ww/~av/forum.dubinush...hp?showforum=42 ] . ... atz . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: /ww/~av/lycos.com ] . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: /ww/~av/forum.dubinush...dex.php?act=idx ] . ...

Еще в разделе: (Показать все результаты (>1198) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Los Alamos Technical Reports and Publications
• Студенческий форум Физфака МГУ > феноменальное видео ! (знающим английский...
• Мафия-6, день первый - Студенческий форум Физфака МГУ

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Multi-threaded search engines . ... Unfortunately, most documents on search engines I saw in the Internet were either lists of hyperlinks without any comments, or discussions about how many documents are in the database of ... (here is the name of a search engine) and what method of counting of the number of documents was used. No words about the efficiency, i.e. how many documents on some subject I can find using this search engine, especially in comparison with the other ones. ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

... Neutral endopeptidase neprilysin is copurified with Na,K-ATPase from rabbit outer medulla and hydrolyzes its alpha-subunit. ... Liquid chromatography/tandem mass spectrometry (LC/MS/MS) analysis showed that the neutral membrane-bound endopeptidase neprilysin is located in one protein band together with the Na,K-ATPase alpha-subunit. Addition of thiorphan, a specific inhibitor of neutral endopeptidase, eliminates proteolysis of the alpha-subunit. ...

Еще в разделе: (Показать все результаты (>39) - biochem.bio.msu.ru/ )

• Cardioprotective effect of histidine-containing dipeptides in pharmacological
• Structure and properties of chimeric small heat shock proteins containing
• Glutathionylation of the alpha-subunit of Na,K-ATPase from rat heart by

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>14) - optics.sinp.msu.ru/ )

• polist99
• zagedan

... Data . ... Solar energetic particles . ... Solar flare database (RU) . ... Select the storm date: . Select storm intensity threshold: . ... Developed in 2007. Copyright €й 2007 - 2016 Skobeltsyn Institute of Nuclear Physics Moscow State University Feedback ...

Еще в разделе: (Показать все результаты (>19) - smdc.sinp.msu.ru/ )

• ShielDose2 model - Space monitoring data center
• Space monitoring data center

... Molecular mechanics with Gillespie-Kepert force field (GKFF) was applied to the modelling of zinc(II) and cadmium(II) complexes with amino- and pyridil-containing ligands. Despite active interest to a zinc complexes ( for example, in bioinorganic chemistry), the comprehensive force field for a large number of polydentate ligands is not developed so far. ... We established forcee field parameters and calculated geometry for more than 20 complexes of zinc(II) and cadmium(II) with high accuracy. ...

Еще в разделе: (Показать все результаты (>503) - chem.msu.ru/ )

• Colloid-chemical phenomena in wastewater containing lignosulphonates
• Moscow University Chemistry Bulletin Vol. 43, No. 3, P. 200 (2002)
• Moscow University Chemistry Bulletin Vol. 54, No. 5, P. 257 (2013)

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>53) - cdfe.sinp.msu.ru/ )

• CDFE - Centre for Photonuclear Experiments Data - Home page
• Index of /services/wftables
• CDFE => Online Services => Nucleus Ground State Parameters

... Е. з. бДпДкъЦЗ м~ВћМњИ ^ВМЪ йћВЛМВММУ,,У ЛМТЪЛЪЫЪ flВ Мњi ЛТТОВУ,МЛИ, СЫћМ еУТНУ,ТНУИ УћО. ї бi еВ, Е.з., 1996 ( ), . ... бДпДкъЦЗ Е.з. зйЗДь ланмДсаь З дЗДзнйЗйв еЦпДзадЦ 81 ). .. , . ... V = const sin(kx) ( cos(kx), exp(ikx), exp(- ikx)), k = E - V . V. , , , = 0 = a ( , 82 лйкйлйЗлдав йЕкДбйЗДнЦгъзхв ЬмкзДг, <7, 1996 ). , , , ( ). sin(nx) c : n = 1, 2, 3, ... , = 1, 4, 9, ... (. . ... 4. (, ) ( ). 86 лйкйлйЗлдав йЕкДбйЗДнЦгъзхв ЬмкзДг, <7, 1996 зЦгазЦвзхЦ мкДЗзЦзаь , V(x) S(E ) , , , . ...

Еще в разделе: (Показать все результаты (>108) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Konstantinova.pdf

. Deprecated : mysql_connect(): The mysql extension is deprecated and will be removed in the future: use mysqli or PDO instead in /wcmc/lms/lms/includes/database.mysql.inc on line 31 . Warning : mysql_connect(): Can't assign requested address in /wcmc/lms/lms/includes/database.mysql.inc on line 31 . Can't assign requested address

Еще в разделе: (Показать все результаты (>4) - lms.cs.msu.su/ )

... Supercomputer molecular modeling of thermodynamic equilibrium in gas-metal microsystems" . Podryga V.O., Polyakov S.V., and Puzyrkov D.V. This paper is devoted to the supercomputer modeling of thermodynamic equilibrium in microsystems containing different substances in various aggregate states. ... Podryga V.O. тАУ Keldysh Institute of Applied Mathematics, Russian Academy of Sciences; Miusskaya ploshchadтАЩ 4, Moscow, 125047, Russia; Ph.D., Scientist, e-mail: pvictoria@list.ru . ...

Еще в разделе: (Показать все результаты (>147) - num-meth.srcc.msu.ru/ )

• Publication Ethics and Publication Malpractice Statement
• "Discretization of Navier-Stokes equations on moving unstructured meshes"
• "Modeling of interaction between a moving structure and a fluid flow using

Modeling of single top tW+b signal at the LHC Slava Bunichev Moscow State University In collaboration with E. Boos and L. Dudko http://comphep.sinp.msu.ru Single top quark production at the LHC: leading order diagrams for single top production t-channel s-channel associated tW production Single Top tWb processes at the LHC: tWb channel gives a significant contribution to the Single Top signal at the LHC Discriminate single top tWb and tt-bar events 2. ...

Еще в разделе: (Показать все результаты (>113) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/rep_M_QFTHEP.pdf
• http://qfthep.sinp.msu.ru/talks2015/1435297199_SRSamara.pdf
• http://qfthep.sinp.msu.ru/talks2015/Ginzburg_Samara.pdf

... UNИX . ... Conferences . Immutable Page . Comments . ... Attachments . More Actions: Raw Text Print View Render as Docbook Delete Cache ------------------------ Check Spelling Like Pages Local Site Map ------------------------ Rename Page Copy Page Delete Page ------------------------ My Pages Subscribe User ------------------------ Remove Spam Revert to this revision Package Pages Sync Pages ------------------------ Load Save SlideShow . ...

Еще в разделе: (Показать все результаты (>11) - uneex.cs.msu.su/ )

• ForkLanguage - UNИX
• FrBrGeorge - UNИX
• FrBrGeorge/NagiosMap - UNИX