1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

Announcement On November 2-3, 2005 Lomonosov Moscow State University will conduct jointly with the Academy of Cryptography of the Russian Federation the Fourth All- Russian Conference Mathematics and Security of Information Technologies [Cybersecurity?] and jointly with the Center of International Studies, Cambridge University , United Kingdom, Advanced Research Workshop Unconventional ... Sherstyuk V.P. - Security Council of the Russian Federation; 3. ... Organization Committee 1. ...

Еще в разделе: (Показать все результаты (>19) - suny.msu.ru/ )

• http://suny.msu.ru/ru/ProgramMaBIT05En.doc
• Center on Russia and the United States :: Contacts

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... Секрет - новые, технологически "умные" таблетки. ... По размеру таблетка-чип не превышает песчинку. ... According to the pill's manufacturer, the "sensor" can monitor when drugs are taken, how much dosage should be administered while at the same time monitoring a patient's heart rate and body temperature. ... Smart' cancer pill on NHS 28 May 2003 . Smart' pill eases twin nicotine urges 14 Sep 2000 . ...

Еще в разделе: (Показать все результаты (>230) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Клуб выпускников Японского центра МГУ
• Клуб выпускников МГУ: Конференция "Вакансии"
• Клуб выпускников МГУ: CRISIS IN THEORETICAL PHYSICS: THE PROBLEM OF SCIENTIFIC

M.H. Shulman, 2006 Michael H. Shulman TIME AND QUANTUM BEHAVIOR The paper presents an abstract of my talk at the Russian Interdisciplinary Temporology Seminar (23 of May, 2006th ). ... The following statements are argued: · The World time-space structure including its relativistic features are due to the quantum object features. Thanks to de Broglie we understood that each quantum object corresponds with some wave. ... A mathematic "exotics" of the quantum physics consists in two components. ...

Еще в разделе: (Показать все результаты (>325) - chronos.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/anisov_time.pdf
• http://temporology.bio.msu.ru/EREPORTS/bernstein_physicist.pdf
• A. P. LEVICH, A. V. SOLOV’YOV. CATEGORY-FUNCTOR MODELLING OF NATURAL SYSTEMS

... About lab . ... Roadway video passport systems are widely-used for detailed road mapping which allows roadway quality monitoring and repair planning. ... Typical roadway images are strongly differed to each other in colors and texture, some examples are shown below. Typical source images for roadway analisys . ... We use so-called rectified images of the road covering. ... When preprocessing is completed our algorithm is trained on a part of rectified road image with the help of user input. ...

Еще в разделе: (Показать все результаты (>195) - graphics.cs.msu.ru/ )

• GML MatLab Camera Calibration Toolbox | Graphics and Media Lab
• Image-based 3D reconstruction of urban scenes | Graphics and Media Lab
• Moving object phases representation | Graphics and Media Lab

Lab . Main page News People . ASA . Master . Master net Homepage . ... Lomonosov Moscow State University Sternberg Astronomical Institute . ... MASTER . ... Lomonosov (ShOK) . ... About Space Monitoring Laboratory, scientific directions, instruments, contacts . People, who work in lab . Latest news and news archive . ... GRB 111215A: MASTER-Net optical prompt and follow up observations GCN 12687 . ... All news ...

Еще в разделе: (Показать все результаты (>35) - master.sai.msu.ru/ )

• Ya.B. Zeldovich All-Moscow Seminar of Astrophysicists

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>59) - geophys.geol.msu.ru/ )

• TES. Field example.
• TRF_2d. Page 4.
• TES tecnology. MSU.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Technical >> Network (Archive) . ... сервис чтобы полечать по мейлу www страничеки... 01.07.2005 17:05 . ... Re: сервис чтобы полечать по мейлу www страничеки... [ re: Hide ] . ...

Еще в разделе: (Показать все результаты (>4507) - www.snto-msu.net/ )

• как настроить smb.conf и запустить демоны smbd и nmbd? - Public forum of MSU
• как в матлабе записать квадратную матрицу в файл тхт? - Public forum of MSU
• Outlook и HELO command - Public forum of MSU united student networks

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>160) - www.pereplet.ru/ )

RUSSIAN BAT RESEARCH GROUP . ... Bat Research . Russian Bats . ... Russian Bat Research Group . WELCOME TO THE RUSSIAN BAT RESEARCH GROUP HOMEPAGE! The Russian Bat Research Group (RBRG) was established following the resolution of the VIIth All-Russian Bat Research Conference (13-16 April 1999) as an executive branch of the Chiropterological Commission of the All-Russian Theriological Society (Russian Academy of Sciences). THE MAIN GOALS OF THE RUSSIAN BAT RESEARCH GROUP ARE: . ...

Еще в разделе: (Показать все результаты (>1053) - zmmu.msu.ru/ )

• Uropatagium venation pattern in bats as diagnostic character (by the example of
• Russian Journal of Theriology
• News and events of RBRG

... Executing config_lcgenv Executing config_java Executing config_ glite _tar_ui gLite Security Utilities configuration successfully completed xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx Configuring the gLite R-GMA Client xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx Checking configuration values [ OK ] Verifying the / gLite / glite / etc ... Configuring BDII based Service Discovery [ OK ] Configuring R-GMA based Service Discovery .. ...

Еще в разделе: (Показать все результаты (>10) - lhe.sinp.msu.ru/ )

• Atlas

О лаборатории . ... На сайт добавлен пакет Lightbox 2.04 (http://www NULL .huddletogether NULL .com/projects/lightbox2/) (by Lokesh Dhakar) для отображения графики с дополнительными визуальными эффектами: . http://www NULL .huddletogether NULL .com/projects/lightbox2/images/image-1 NULL .jpg) (http://www NULL .huddletogether NULL .com/projects/lightbox2/images/image-2 NULL .jpg) . ... Tags: site lightbox . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>11) - geo.sai.msu.ru/ )

• Hello world! Лаборатория лазерной интерферометрии
• elstream.ru: онлайн видеотрансляции с Эльбруса Лаборатория лазерной
• Northern Lights over Norway Лаборатория лазерной интерферометрии

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>30) - www.sciencepark.ru/ )

• MSU Science Park - Services
• MSU Science Park - Venue & Space
• MSU Science Park

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>16) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>20) - rswater.phys.msu.ru/ )

... 119991, Moscow, GSP-1, Leninskiye Gory, MSU, 2nd Educational Building, CMC Faculty, room 581 (Head of the laboratory) . ... The Laboratory of Industrial Mathematics (LIM) headed by Professor V.M. Goloviznin was established in the Faculty of Computational Mathematics and Cybernetics (CMC) of Lomonosov Moscow State University in 2011. ... Running specialised computer modelling and simulation, high-qualification and certification courses targeted at the engineers of the leading Russian industry. ...

Еще в разделе: (Показать все результаты (>94) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics
• Laboratory of Mathematical Methods of Image Processing | CMC MSU
• Laboratory of Mathematical Methods of Image Processing

... On Applications of Group Analysis of Differential Equations in Analytical Dynamics. ... I.S.Yemelyanova (Nizhny Novgorod State University, Nizhny Novgorod, Russia) . ... A course "Group analysis of differential equations and its applications'' [1,2] for Nizhny Novgorod State University students and postgraduates contains group theoretical methods in analytical mechanics. ... Nizhny Novgorod: Univ. ... Yemelyanova I.S. Group analysis of differential equations. ...

Еще в разделе: (Показать все результаты (>107) - acs366.phys.msu.su/ )

• Abstract (Invited)

... to Composite Mechanics Chair. was based at Mechanical & Mathematical Department in 1987. ... Address: Composite Mechanics Chair, Mechanical & Mathematical Department, Moscow State University, Moscow 119899, Russia. ... The Department of the Composites Mechanics was found at the Faculty of Mechanics and Mathematics of Lomonosov Moscow State University (MSU) in 1987. ... Optimisation of numerical methods in Solid Mechanics . Application of asymptotical methods in Composites Mechanics . ...

Еще в разделе: (Показать все результаты (>3) - composite.msu.ru/ )

• Pobedria Boris Efimovich

... Dear book contributors of the NATO ARW, . following the ARW workshop the organizing committee has agreed to the following procedure in order to expedite the process of preparation, distribution and review of the individual manuscripts: . ... The manuscripts received will be sent by Norbert Hertkorn (GSF-Germany) and Irina Perminova (MGU/Russia) for review, typically to two different other authors which also have been participants of the NATO ARW, or to the independent appropriate reviewers. ...

Еще в разделе: (Показать все результаты (>110) - mgumus.chem.msu.ru/ )

• MGUMUS -- Current projects