... Data . ... Planetary perturbations during geomagnetic storms are measured by the Dst index, which is the deviation of variation of the magnetic field from the undisturbed level, averaged over the values measured at the control chain of magnetic stations located in the low latitudes. ... To predict the hourly values of the Dst index, artificial neural networks (ANN) of perceptron type are used. ... Loading of the data on the values of the Dst index and forecast update are performed twice per hour. ...

Еще в разделе: (Показать все результаты (>12) - swx.sinp.msu.ru/ )

• SWX - Главная

... FPGA design, architecture, means and methods of work. ... FPGA stands for Field-Programmable Gate Array, which is a semi-conductive crystal, the connections between gates of which and the logic of work can be modeled and changed repeatedly during its work. ... Each semester has 12 obligatory classes of four (4) academic hours each once a week, which totals in 48 hours per semester. ... In spring semester students have 44 hours to work on their term papers on design and then 4 hours for defending...

Еще в разделе: (Показать все результаты (>19) - engineering.phys.msu.ru/ )

• Parallel Programming
• Introduction to Linux

... О кафедре . English . ... Department for Jewish Studies of Lomonosov Moscow State University . ... The Department for Jewish Studies (DJS) was established in 1998. ... The students take courses offered by the School (the Institute of Asian and African Studies), as well as courses offered by the Jewish Studies Department. ... The Department regularly accepts university teachers of Jewish and Israeli Studies from Russia and the FSU in order to upgrade their professional level. ...

Еще в разделе: (Показать все результаты (>3) - cjs.iaas.msu.ru/ )

• Кафедра иудаики ИСАА МГУ
• Новости - Кафедра иудаики ИСАА МГУ

Fortran-DVM Compiler . Detailed design . ... 3.1 Parsing . 3.2 Transforming parse tree . 3.3 Generating code in Fortran 77 . ... 4.2 Symbol and Type table . ... This report presents the detailed description of the Fortran-DVM (FDVM) compiler implementation. ... The input to the compiler is source code in Fortran DVM or HPF-DVM language. ... It is designed as an open C++ class library that provides a set of parsers, a structured parse tree, a symbol and type tables for a user. ... dvm.cpp . ...

Еще в разделе: (Показать все результаты (>151) - sp.cs.msu.ru/ )

• Prefictor of DVM-program performance. User's guide
• Performance Analyzer. Detailed design
• Index of /images/olymp2001/sources

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>240) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/16.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/18.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>174) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced
• MUSCLE User Guide

... Finance for Start-Up . ... Инновационная . структура МГУ . ... Обучение инновационному менеджменту . ... деятельности . ... Process of Forming a Company . ... Typical business development & equity scenario . ... Unfortunately, there is no single type of financing appropriate for all start-up companies and no single path to accessing money. ... 2005 Управление инновационной политики . и организации инновационной деятельности . МГУ им. М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>54) - innovation.msu.ru/ )

... Download NPG-explorer . ... Build nucleotide pangenome . ... Here we provide a table for 3 Brucella genomes: all: embl :CP002459 BRUMM chr1 c Brucella melitensis M28 chromosome 1 all: embl :CP002460 BRUMM chr2 c Brucella melitensis M28 chromosome 2 all: embl :CP003176 BRUAO chr1 c Brucella abortus A13334 chromosome 1 all: embl :CP003177 BRUAO chr2 c Brucella abortus A13334 chromosome 2 all: embl :CP002078 BRUPB chr1 c Brucella pinnipedialis B2/94 chromosome 1 all: ... Fix bugs....

Еще в разделе: (Показать все результаты (>6954) - mouse.belozersky.msu.ru/ )

... Number of required sensors is 10000 4 The part of ANTARES collaboration (http://antares.in2p3.fr/Collaboration/index.html) 5 The some direction of MSU group activity in the project Ї Bioluminescence cut Ї Quality cuts Ї SN search 6 Bioluminescence cut We have collected distributions of hit counts for each PMT during one K40 run (~45min) Usually these distributions consist of 2 parts ґ Poissonian (due to K40 and plankton ... Conclusion Bioluminescence cut was done. ...

Еще в разделе: (Показать все результаты (>23) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/2010_Amsterdam_Kulikovskiy.pdf
• http://antares.sinp.msu.ru/docs/Ershova%20-%20Acoustic%20field%20eng.pdf
• http://antares.sinp.msu.ru/docs/INFN%20-%20Paper%203.pdf

... Structure of Data . ... Catalog . ... In SAI OCL Catalog, we introduce our work on investigation of the Milky Way system of open star clusters. The main goal of our study is a search for new clusters using huge surveys. 168 new clusters have been already discovered by us using J,H,Ks data from 2MASS point source catalog. ... For 141 new clusters, we found their physical parameters using J,H,Ks data from 2MASS catalog and, for a number of clusters, our UBVRI CCD observational magnitudes. ...

Еще в разделе: (Показать все результаты (>4) - ocl.sai.msu.ru/ )

Olga1glm@googlemail.com Relativistic diffractional generators (RDG) are promising sources for generation of longpulsed high power coherent microwave radiation in the centimetre and millimetre wavelengths range. ... 0 100 200 300 400 : ( E08) 2- ( D/~8 D=11.1 ), 2- ( D=12). ... 2 D=11.1 ( ) 4 , 6 8 , 11 . 5 4 3 4kA , % ) 6kA 11kA 8kA 0 ) 4kA , % -2 -4 2 1 0 0 100 200 300 400 6kA -6 -8 11kA 8kA -10 0 100 200 300 400 t/T, . ... T t 2 100 , T . ... 1990. ...

Еще в разделе: (Показать все результаты (>185) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/200809/Litvinovich.pdf
• http://nuclphys.sinp.msu.ru/conf/epp10/Weiler.pdf
• http://nuclphys.sinp.msu.ru/school/s09/09_11.pdf

HETEROGENEOUS SYSTEM IN RADIATION PROTECTION Iakubova K., Mazilov A.№ V.N. Karazin Kharkiv National University School of Physics and Technology, Biological and Medical Physics Department Ukraine, 61077 Kharkov, ploschad' Svobody 4, Tel.: ... 057) 335-63-45 E-mail: mazilov@kipt.kharkov.ua In the present work the features of attenuation of gamma radiation from spent nuclear fuel fragment of a multilayer system of tungsten and aluminum is theoretically and experimentally investigated. ...

Еще в разделе: (Показать все результаты (>272) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc24669/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc97181/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc151123/eng.pdf

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>5) - textbook.sinp.msu.ru/ )

ERC Synergy Grant Call for Proposals Call Title: Call for proposals for ERC Synergy Grant Call identifier: ERC-2012-SyG Date of publication1: 25 October 2011 Electronic proposal submission deadline2 (single submission of full proposal): 25 January 2012 17.00.00 (Brussels local time) Indicative budget: EUR 150m from 2012 budget3. The final budget awarded to this call, following the evaluation of projects, may vary by up to 10% of the total value of the call. ...

Еще в разделе: (Показать все результаты (>38) - ideas.msu.ru/ )

• http://www.msu.ru/int/newpr/7ram/7ram_prez.pdf
• http://ideas.msu.ru/docs/press_release_2012.doc
• http://ideas.msu.ru/docs/call_StG_2012.pdf

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

76. Новинки программного обеспечения - Public forum of MSU united student networks

77. http://www.socio.msu.ru/vestnik/archive/2013/3/06.pdf

78. BarChart

79. http://site2010.sai.msu.ru/static/doc/DAfshari.pdf

80. screens (log) тАУ Python Battle