THE THIRD ANNUAL STUDENTS' SCIENTIFIC CONFERENCE ON TODAY'S TOPICAL POLITICAL AND PHILOSOPHICAL ISSUES Panel of philosophy ALEXANDER BOURGANOV AND HIS `NEW ROMANTICISM' CONCEPTION Liyamina Anastasiya Faculty of philosophy 1st year student Alexander N. Bourganov occupies an important place among famous masters of modern sculpture. ... He tries to find philosophical foundation for mathematics. ... Existential dread is examined by Kierkegaard in his work "The concept of anxiety". ...

Еще в разделе: (Показать все результаты (>73) - ffl.msu.ru/ )

GDE alignment format is one of standard alignment formats. A popular program for sequence alignment, Clustal, for example, can save alignment in this format. In this format, all letters indicating amino acids are in lower case, gaps are indicated by dashes. Sequences are placed one after another, name of each sequence is placed onto a separate line and begins with ‘%’. The sequence is placed afterwards beginning on the next line and may be broken into several lines. ...

Еще в разделе: (Показать все результаты (>9) - bioinf.fbb.msu.ru/ )

Igor S. Dubenko . ... Magnetism in condensed matter, Physical properties of rare earth intermetallic compounds, magnetic and electrical properties of molecular clusters and compounds with giant magnetoresistance, magneto-electric effect, superconductivity. ... I.S. Dubenko , I.Yu. Gaidukova, E. Gratz, K. Inoue, A.S. Markosyan, V.E. Rodimin, Magnetic instability of the Co sublattice in the Ho 1? x Y x Co 3 system, Physica B 319 (2002) 21-27. ... Magn. 36 (2000) 3336-3338. ...

Еще в разделе: (Показать все результаты (>5) - ferro.phys.msu.ru/ )

• Department of General Physics and magneto-ordered matter. Physics Faculty of
• Physics Department of Moscow State University

. M. Prohorow, S. Kuranow . D. Kosenko stand . against background . of Donguz-Orun . At the mountain . Cheget . From the mountain . Cheget . Return from Azau . Walk with Darja Kosenko . along Cheget Slopes . Into Andyrchi to the . Ga-Ge-neutrino-detector . Scintillator-detector . W. Lukash, M. Prohorow, . D. Kompaneetc and i were . waiting for airplain . The day of waiting . for airplain . The Great Seven

Еще в разделе: (Показать все результаты (>11) - astrometric.sai.msu.ru/ )

• AMT articles

Man of the year Awards 3rd Place goes to [pic] 2nd Place goes to [pic] and the winner of the man of the year goes to [pic]

Еще в разделе: (Показать все результаты (>309) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: КАК ОБОСНОВАТЬСЯ В КАНАДЕ: ПЕРВЫЕ ШАГИ (часть 4)
• Клуб выпускников МГУ: Questions from non-canadians (smile :-))

... We need a new education quality, which will inevitably lead us towards wider possibilities of self-fulfilling of our citizens - in the first place, the young generation. ... The key factors to form the new quality of the higher education are, first - science and economy integration, universities must be "generators of ideas", and second - adjusting of education programs in order to prepare highly qualified specialists, essential for society. ... RF Education and Science Minister A.A. Fursenko ...

Еще в разделе: (Показать все результаты (>34) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/461.pdf
• http://www.rsr-online.ru/doc/2011_03_29/6.pdf

в строке vstr, заменяет vpat на vrep ====== function replace(vpat,vrep,vstr) { var myindex=vstr.indexOf(vpat); var replen=vrep.length; if (myindex != -1) { var vstr1=vstr.substring(0,myindex)+vrep; var vstr_con=vstr.substring(myindex+replen); vstr1+=replace(vpat,vrep,vstr_con); return vstr1; } else { return vstr; } } function isEmpty( vdata ) { if ( vdata.length 0) { for ( var i=0; i vdata.length ; i++) { if ( ...

Еще в разделе: (Показать все результаты (>20) - genphys.phys.msu.su/ )

... Is it necessary to do the beam weaker? ... Q: If the mixture of powders consists of both isotropic and anisotropic particles, is it possible to estimate the ratio of isotropic and anisotropic parts? If I understand the question correctly, one asks, if one has a fraction of oriented anisotropic particles and a fraction of the disoriented anisotrpic particles (i.e. one has somewhat partial texture in the powder sample), then is it possible to find out these fractions? ...

Еще в разделе: (Показать все результаты (>11) - www.elch.chem.msu.ru/ )

• Molecular aspects of solid state and interfacial electrochemistry
• Oleg A. Petrii
• Laboratory of Electrochemical energetics

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>13) - comphep.sinp.msu.ru/ )

• download:rn-061106 [CompHEP]
• new-mac [CompHEP]

... Faculty of Basic Medicine, Lomonosov Moscow State University and State Research Center ­ Institute for Biomedical Problems, Russian Academy of Science invite you to take part in "VI Russian National School with International Participation on Muscle and Exercise Physiology "Systemic and cellular mechanisms in physiology of motor system". ... We invite scientists, post-grade students, residents and students to take part in School on systemic and cellular mechanisms in physiology of motor system. ...

Еще в разделе: (Показать все результаты (>9) - fbm.msu.ru/ )

XIV International Ornithological Conference of North Eurasia 2nd Information Letter Dear colleagues! Conference Committee acknowledges that XIV International Ornithological Conference of North Eurasia will take place on 18-24 August 2015 in Almaty (Kazakhstan), hosted by Al-Farabi Kazakh National University. ... Registration forms and abstracts with the proposed status of the presentation (sectional presentation or poster) are still welcomed up to 1 December 2014. ...

Еще в разделе: (Показать все результаты (>895) - zmmu.msu.ru/ )

• Наши поездки
• XIV International Ornithological Conference of North Eurasia: Excursions
• Russian Journal of Theriology

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>148) - www.genebee.msu.ru/ )

• BLAST Frequently Asked Questions (FAQ)
• AliGraf - GeneBee Graphical Alignment Help
• Picornaviruses: discovering big in small

... Conference Venue . ... The conference will take place at the Lenin Hill campus of the Lomonosov Moscow State University one of the most prestigious higher education institutions of Russia. ... The conference meetings will take place in the building of the Department of Chemistry of the Lomonosov MSU . ... The catering of conference participants (three meals) and coffee-breaks will take place in the canteen of the Department of Chemistry. ...

Еще в разделе: (Показать все результаты (>92) - mgumus.chem.msu.ru/ )

• MGUMUS Home Page
• MGUMUS -- Second International Conference of CIS IHSS on Humic Innovative
• MGUMUS -- Third Conference of CIS IHSS on Humic Innovative Technologies Humic

... On the 11 th of November there was a birthday of the greatest Russian writer Feodor Dostoevsky. (more.. 19.11.2003 . ... There are people! ... Dolce vita in Russia . ... The new course for foreign students and native Russians is to be started. ... The Russian language centre gives you an opportunity to become a teacher of Russian. (more.. ... Russia is getting closer to the European Community. ... Students, wake up Siberia! ... Russian proverbs and sayings about Russian language: . ...

Еще в разделе: (Показать все результаты (>8) - www.rlcentre.com/ )

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>16) - observ.pereplet.ru/ )

... Academic Programmes . ... Russian Language Programmes . ... A balanced program of speaking, listening, writing and reading skills ensure that all students make progress as quickly as possible. ... Listening/Speaking : you will be able to understand basic instructions or take part in a basic factual conversation on a predictable topic. ... Reading : you will be able to read quickly enough to cope with an academic course, to read the media for information or to understand non-standard correspondence. ...

Еще в разделе: (Показать все результаты (>29) - www.cie.ru/ )

• Students? Life :: CIE
• Cultural Programmes and Excursions :: Academic Programmes :: CIE