... Multi-Resolution FFT: MR FFT), .. STFT : ( . ... STFT), : , ?ґ , (Short Time Fourier Transform: STFT) . ... This approach is able to improve quality of many audio processing algorithms (such as noise reduction) by adaptively varying STFT time-frequency resolution based on local properties of the signal: estimates of spectrogram sparsity. ... The effect of this adaptive algorithm is selection of high frequency resolution for tonal signals and selection of high time resolution for transients. ...

Еще в разделе: (Показать все результаты (>139) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2011.Graphicon.Chernomorets_Krylov_Nasonov_Semashko.Retina.en.pdf
• Software projects | Laboratory of Mathematical Methods of Image Processing
• Research | Laboratory of Mathematical Methods of Image Processing

Analysis of the ANTARES data for SN neutrino detection V. Kulikovskiy (MSU / INFN Genova) Hit counts in the detector. The number of hits ( hit counts ) in a time slice (104.8 ms) is used (this information is stored in each run) Mean number of hit counts in one PMT is ~5500 (corresponds to ~55 kHz) Expected number of hits from SN in 100ms is 11.6 ( 550 0) Bioluminescence bursts should be excluded Bioluminescence cut We have collected distributions of hit counts for each ...

Еще в разделе: (Показать все результаты (>18) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Gracheva.pdf

... Abstract A. V. Dmitriev, A. V. Ivanov, A. R. Khokhlov, Numerical simulation of light propagation through a diffuser, Fundamentalnaya i prikladnaya matematika, vol. 15 (2009), no. 6, pp. ... In this article, the light propagation in a diffuser with optically soft inclusions is described with the help of the Fokker--Planck equation, i.e., a transfer equation with a diffusion term in the space of radiation propagation directions. ... 8, 9] , x1 , : 1 D = (3 - x1 ), 6 3 x1 = 2 d x( )cos sin . ...

Еще в разделе: (Показать все результаты (>16) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/science/redistr-sst99.pdf
• http://lizard.phys.msu.su/home/science/redistr-sst99.ps.gz

... FPGA design, architecture, means and methods of work. ... FPGA stands for Field-Programmable Gate Array, which is a semi-conductive crystal, the connections between gates of which and the logic of work can be modeled and changed repeatedly during its work. ... Each semester has 12 obligatory classes of four (4) academic hours each once a week, which totals in 48 hours per semester. ... In spring semester students have 44 hours to work on their term papers on design and then 4 hours for defending...

Еще в разделе: (Показать все результаты (>22) - engineering.phys.msu.ru/ )

• Microcontroller Programming

... The Cold war was over. But, as after World Wars I and II, the defeat of the enemy does not mean the end of the international conflict. ... Russia stands in front of the examples of European Integration so the main priority in the Foreign Policy of Russia in international economic relations is to promote the development of the national economy, which, in conditions of the Globalization process, is unthinkable without broad integration of the country in the system of world economic ties. ...

Еще в разделе: (Показать все результаты (>105) - www.prof.msu.ru/ )

• SYSTEM INTERFACE AND SYSTEM COUPLING: ANDY WARHOL AND ART MACHINE

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>49) - sn.sai.msu.ru/ )

... The bright supernova (hereafter SN) in the galaxy NGC 4527 was first sighted by S. Knight (USA) on April 13.17UT at magnitude ~14.0v. The report of the sighting was subsequently forwarded by phone to the AAVSO. ... SN 1991T. The galaxy NGC 4527 is an Sb(s)II type galaxy with an apparent Blue magnitude of 11.32 (Shapley-Ames, 1981). ... An analysis of this event utilizing visual observations by amateurs, plus a light curve is presented.. ... THE LIGHT CURVE: . ... ISN SN 1991T web page . ...

Еще в разделе: (Показать все результаты (>27) - www.rochesterastronomy.org/ )

• SN1989B in M66
• Images of Supernova 1998S in NGC 3877
• Supernova 1999gp in UGC 1993

... While assessing the effects of vegetation burning on soil properties, Mills Fey (2004) proposed the term pedoderm to describe those first few centimetres of soil in which certain properties are often expressed much more strongly than in the remainder of the soil surface horizon. ... The pedoderm hosts or serves as substrate for the formation of both biological and physical crusts of the kind described, respectively, by Belnap and Lange (2003) and Singer and Shainberg (2004). ... 2003; Cadenasso et...

Еще в разделе: (Показать все результаты (>142) - www.fadr.msu.ru/ )

• http://www.paleopedology.msu.ru/discussions/messages/64.html
• http://www.paleopedology.msu.ru/discussions/messages/45.html
• http://www.paleopedology.msu.ru/discussions/messages/243.html

... H: Ї 1 ґ Al2O3ґNa3AlF6 (T - x) = 1 , ґ , ґ 1 ( ґ ); Ї 1 ґ Na2SO4ґH2O (T - x) = 1 ( ); Ї 25° ( .. ... Na2SO4ґH2O Na2SO4 10H2O, Na2SO4 + 10H2O Na2SO4 10H2O. , , , . ... 6, 7) LiBr KBr, , : L LiBr() + KBr() . ... 1) , , KBr. ... L. PbTeґSnTe PbSeґSnSe PbTe PbSe, , (.. ... BeF2ґLiF , ( ), LiBeF3 Li2BeF4 BeF2ґLiF (. ... LiBeF3 280°, BeF2 Li2BeF4 : LiBeF3 () ґ Na2SO4 7H2O: Na2SO4 + 7H2O Na2SO4 7H2O. : Na2SO4 7H2O() Na2SO4 10H2O() Na2SO4 () Na2SO4 () +L 24° BeF2 () + Li2BeF4 () . ... Na2SO4ґH2O Na2SO4ґH2O....

Еще в разделе: (Показать все результаты (>46) - www.inorg.chem.msu.ru/ )

• Ardashnikova E.I.

. Sites . Remove access privilege . You can remove yourself from the Owner, Collaborator, or Viewer list from this site by clicking the "Remove Access" button. Once access is removed it can not be undone by yourself. Remove access . Cancel

Еще в разделе: (Показать все результаты (>2) - cjs.iaas.msu.ru/ )

• Report Abuse

Lessons learned from the Thirty Meter Telescope site testing Tony Travouillon Sebastian Els, Angel Otarola, Reed Riddle, Matthias Schoeck, Warren Skidmore TMT.XXX.PRE.05.0XX.DRF01 1 Introduction TMT and its Site testing. Important choice before going on site. ... Considerations during analysis of the data. TMT.XXX.PRE.05.0XX.DRF01 2 Some Background about the TMT Site Testing TMT is a 30m, segmented, RitcheyChretien telescope design. ... ASCA Cloud Cover Analysis So how do we do it in practice? ...

Еще в разделе: (Показать все результаты (>218) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/BSafonov_site2010.pdf

Date: 06/99 Title: Mean-field approximation for stochastic transportation network and stability of dynamical system Authors: D.V. Khmelev and V.I. Oseledets Abstract: A queuing system is considered, with a virtual node, $N$ nodes, and $rN$ servers. At each node (of these $N$ nodes) the arrivals of particles form a Poisson flow of rate $\lambda(t)$. For an empty node a particle leaves the system. A server at the node takes the particle and moves to a random node. ...

Еще в разделе: (Показать все результаты (>59) - old.philol.msu.ru/ )

• Using Markov Chains for Identification of Writers
• Basic Assumptions about a Sign's Life Cycle for Mathematical Modelling of
• MSU-LGCLL:: DicTUM-1 - A System for Dictionary-Text Universal Manipulations and

... Take latest Pacman and install it : Create somewhere directory software/ and simply untar Pacman there : cd software wget http://physics.bu.edu/pacman/sample_cache/tarballs/pacman-latest.tar.gz tar xzf pacman-latest.tar.gz # It will be created, for example, directory pacman-3.21/ rm -f pacman-latest.tar.gz ln -s pacman-* pacman cd pacman source setup.csh # or setup.sh cd .. ... For instance, if you do pacman -allow tar-overwrite this setting remains as a default until you change it. ...

Еще в разделе: (Показать все результаты (>10) - lhe.sinp.msu.ru/ )

Using stand-alone SDPfox . ... To add a new specificity group, type in the group name and press "Add" . To change composition of specificity groups, select two groups: first, from which to remove sequences, and second, to which to add sequences. ... For a constructed grouping, it is possible to run SDPgroup, re-randomize grouping or move sequences according to the best weights (see algorithm) under the link 'SDPgroup'. ... These sequences are likely to be re-grouped after SDPgroup is performed. ...

Еще в разделе: (Показать все результаты (>138) - bioinf.fbb.msu.ru/ )

• User's guide
• SDPsite - Gallery of examples
• SDPsite - Algorithm Format requirements

... Shape and size of leaf blades and pollen grains are important diagnostical characters in many plant groups. ... We made quantitative investigations of changes of shape and size of fresh leaf blades during herbarization and also of pollen grains after acetolysis and in fine vacuum during SEM for Nymphaea species in the European Russia. We found out that during herbarization the length of the leaf blade decreases in 1,05-1,4 times and its width decreases in 1,15-1,5 times. ...

Еще в разделе: (Показать все результаты (>244) - herba.msu.ru/ )

• The flower organ transition in water-lily
• Материалы к полевому сезону
• Vascular plants' distribution on the islands

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>15) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>5) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt
• Page has moved

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>7) - storage.bioinf.fbb.msu.ru/ )

... 7, 10253, 2005 SRef-ID: 1607-7962/gra/EGU05-A-10253 ? European Geosciences Union 2005 Enhanced detoxifying ability of the specifically oxidized humic derivatives with respect to copper V.A. Kholodov (1), N.A. Kulikova (1), G.F. Lebedeva (1), A.N. Kovalenko (2) and I.V. Perminova (2) (1) Department of Soil Science ... Experimental Section Humic materials used; methods of their oxidation and characterization. ... Toxicity of copper was estimated using seedling technique. ...

Еще в разделе: (Показать все результаты (>120) - mgumus.chem.msu.ru/ )

... Information for the applicants . ... News . ... The Faculty of Bioengineering and Bioinformatics, Lomonosov Moscow State University was founded in 2002 with the express purpose of training of highly qualified personnel for the universities, research institutes, medical companies and facilities, and pharmaceutical and biotechnology industries. ... Faculty of Bioengineering and Bioinformatics, office 433. ... 2016 Faculty of Bioengineering and Bioinformatics, . Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>10) - en.fbb.msu.ru/ )

• Background? Faculty of Bioengineering and Bioinformatics, MSU