... About Trac . Wiki . ... trac . ... The Trac Wiki Engine = ѓЉ . ... Trac has a built-in wiki engine, used for text and documentation throughout the system. ... Editing wiki text is easy, using any web browser and a simple [WikiFormatting formatting system], rather than more complex markup languages like HTML. ... Note though that Trac also supports [ wiki:WikiHtml HTML], [wiki:WikiRestructuredText reStructuredText] and [http://www.textism.com/tools/textile/ Textile] as alternative markup formats . ...

Еще в разделе: (Показать все результаты (>3814) - kodomo.cmm.msu.ru/ )

• Changeset 96:3619305694ad тАУ Python Battle
• WikiProcessors тАУ Tanchiki
• WikiFormatting ? Tanchiki

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>18) - mouse.belozersky.msu.ru/ )

• wLake program homepage
• LCore
• Geometrical core

... Copyrightї1997 Bob Yen (byen@ix.netcom.com) (http://www.comet-track.com/hb/hb.html) . ... Information on Comet Hale-Bopp for the Non-Astronomer Hale-Bopp rotates about twice a day (3/14/97) . ... The Comet Observation Home Page was been selected to receive the Griffith Observatory Star Award for the week of February 2 - 8, 1997 for excellence in promoting astronomy to the public through the World Wide Web. ... Typically, about 1,000 individual users/computers access this page every day. ...

Еще в разделе: (Показать все результаты (>15) - www.issp.ac.ru/ )

... PyMol is a powerful drawing instrument and here we show how to plot Fukui function with PyMOL after two calculation steps with FireFly (PC-GAMESS). ... Because total HOMO orbital have two electrons and should be divided by two (see equations at the beginning). 1 комментарий " Building and plotting Fukui function with FireFly and PyMol " . Quantum chemistry information page ERG Research Group: Лаборатория теоретической биофизики написал (Май 20th, 2015 12:43 пп) . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>35) - erg.biophys.msu.ru/ )

• Using RESP with GAMESS-US and Firefly (PC-GAMESS) ERG Research Group:
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>123) - www.msu.ru/ )

INVOLUTION DIFFEOMORPHIC OF MANIFOLDS TO REAL WITH A SET PROJECTIVE OF FIXED POINTS SPACE UDC 517.83 A. S. Mishchenko It is proved that if, on a manifold with an involution, the subset of fixed points is diffeomorphic to an even-dimensional real projective space, then the manifold is bordant to the complex projective space in the class of nonoriented bordisms. ... For each manifold Mn, there is a manifold with involution N 2n such that Mn is its set of fixed points. ...

Еще в разделе: (Показать все результаты (>251) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/people/taras/TTC/slides/kamiyama.pdf
• http://higeom.math.msu.su/people/taras/talks/2012tokyo-talk.pdf
• Publications (English)

CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...

Еще в разделе: (Показать все результаты (>15) - astrometric.sai.msu.ru/ )

• Astronomy

Title Should Be in Bold, 18-Point Type and Centered, Please Use Title Case Author name(s) [10-point type, centered, bolded] Author affiliation and full address (8-point type, centered, italicized) Author e-mail address: (8-point type, centered, italicized) Abstract: Indent left and right margins 0.5 in. (1.27 cm), justify the paragraph (on both right and left), and use the same font as in the body of the paper. ... 5] Author(s), "Title of paper," in Title of Proceedings, Name(s), ed(s)., ...

Еще в разделе: (Показать все результаты (>10) - iconolat13.phys.msu.ru/ )

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>21900) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/internet-drafts/draft-bertz-alto-mobilitynets-00.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc569.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc569.txt

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>161) - www.pereplet.ru/ )

Russian depictives and attributives: the role of the verb Russian secondary predicates can use two different case patterns: the instrumental case or the agreeing case. In this paper we discuss the behavior of the adjective in the position of the secondary predicate and we refer to the patterns of agreement discussed above as depictive constructions (taking the instrumental) and attributive constructions (taking the agreeing case), see the examples (1-2). ... Predicate nouns in Russian. ...

Еще в разделе: (Показать все результаты (>367) - www.philol.msu.ru/ )

• LangueDOC :: Archi :: Alphabet
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/ongoing_projects.html

... Separation of all runs on several groups by mean active sectors. ... Ways to carry out step 2: trying to cut off all points which don't reach the fit line with errors. Ways to carry out step 2: mean active sectors selection Ways to carry out step 2: results of mean active sectors selection by example of set 2 Failing of mean active sector selection method on example of set 3: one point is still on the graph Introduction of new distance parameter How to find an optimal distance parameter? ...

Еще в разделе: (Показать все результаты (>20) - antares.sinp.msu.ru/ )

... This course focuses on main characteristics of the ?life? of academic information (its development and diffusion), and on basic algorithms of data retrieval. ... This course consists of four interrelated areas: theoretical introduction (Internetics and information theory), and practical units including the three pillars of information retrieval services: factual, bibliographic and documentary search. ... Factual search. ... Internet-heuristics strategies: summarizing information retrieval skills . ...

Еще в разделе: (Показать все результаты (>158) - hist.msu.ru/ )

• Department of Ancient History
• History of Russia. Electronic resources
• "Novaya i noveishaia istoria" Journal

log . ... Mon, 14 Jan 2013 03:13:04 +0400 . Boris Nagaev . ... Fri, 11 Jan 2013 21:25:33 +0400 . ... Thu, 10 Jan 2013 20:02:04 +0400 . ... Wed, 09 Jan 2013 17:57:24 +0400 . ... Fri, 21 Dec 2012 15:08:34 +0400 . ... Daniil Alexeyevsky . ... Fri, 29 Jun 2012 19:37:28 +0400 . ... Automated merge with ssh://kodomo/allpy . ... Tue, 19 Jun 2012 16:55:44 +0400 . ... Thu, 14 Jun 2012 20:24:26 +0400 . ... Sun, 10 Jun 2012 16:08:47 +0400 . ... Sat, 09 Jun 2012 21:23:11 +0400 . ... Boris Burkov . ...

Еще в разделе: (Показать все результаты (>13616) - kodomo.fbb.msu.ru/ )

• cca: a308291203ea Help/Help.html
• allpy: ef6692b5ffbc
• allpy: ef6692b5ffbc sandbox/ttk.py

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

56. http://qilab.phys.msu.ru/people/grishanin/teaching/program.pdf

57. GeneBee service

58. Fabrik - A Visual Programming Environment

59. http://herba.msu.ru/shipunov/school/biol_154/2010_2011/lec_08.pdf

60. Lobkovskii E.B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического