... Time And Public Policy Interventions Long term political time creates policy windows as legislative, administrative, issue, party, electoral and political actor life-cycles merge.2 Short-term political time seeks to achieve some future good within a highly cyclical and constrained legislative and policy context (legislative committee rules, deadlines, constitutional provisions, voter preferences, etc.) ... Clearly, a public policy time-ecology is a complex adaptive system. ... Time and Public Policy...

Еще в разделе: (Показать все результаты (>329) - chronos.msu.ru/ )

• On the Way to Understanding the Time Phenomenon: the Constructions of Time in
• A. P. LEVICH, A. V. SOLOV’YOV. CATEGORY-FUNCTOR MODELLING OF NATURAL SYSTEMS

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>7) - npidb.belozersky.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... This Python module parses Gaussian cube files, produced by quite a few QM software packages, and makes volume data available as numpy array as well as some associated properties. ... Нет комментариев " Gaussian Cube files loader " . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>22) - erg.biophys.msu.ru/ )

• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6727) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example
• PLANdbAffy: probe-level annotation database for Affymetrix expression

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>13) - comphep.sinp.msu.ru/ )

• overview [CompHEP]
• extra:main [CompHEP]

VES visualization as the dependence Rho a =f ( r ) is suitable for analysis of only HLS . ... For that the special visualization program IPI-2D was developed, which helps to draw VES data in many forms. a) Rho a cross-sections for AMN & MNB pole-dipole arrays give the first representation of structure under investigation, its inhomogeneity and NSI influence (see fig.7 ). b) D - transformations gives the difference between AMN & MNB (D) and its horizontal derivative - dD/dX (R) . ...

Еще в разделе: (Показать все результаты (>59) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>9) - lhe.sinp.msu.ru/ )

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf
• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf

... Statistical Model for Meteorolocal Elements Based on Local Radiosonde Measurements . ... The model is based on the 3-year local radiosonde measurements for the most important for practice strong winds for which the altitude level of the maximum wind is highly expressed. Vertical profiles of meteorological elements measured under quite different atmospheric conditions exhibit qualitative similarity, but differ by the reference scales of wind, temperature and altitudes. ...

Еще в разделе: (Показать все результаты (>113) - acs366.phys.msu.su/ )

• Abstract (Invited)

Distributed systems as pattern formation models: space-time behavior investigation and elements of dynamics control". ... A new method of local dynamics analysis of coupled map lattices (CML) was proposed. ... New effects of global behavior of CML was found. Maps can represent some systems. ... And the points represent state of the system, which was determined by Rybalko method (Lambda values; color = period = order, black = zero period = chaos) and the period of cycle (P values). ...

Еще в разделе: (Показать все результаты (>67) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/Galss_ceramics.pdf

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>248) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• Inquiry information || Distances
• Example of supporting positions

Bazhanova Z.G., Oganov A.R, Gianola O.. Fe-C and Fe-H systems at pressures of the Earth's inner core. ... 2012. ... 489-497. The solid inner core of Earth is predominantly composed of iron alloyed with several percent Ni and some lighter elements, Si, S, O, H, and C being the prime candidates. ... Here, using ab initiosimulations, we study the Fe-C and Fe-H systems at inner core pressures (330-364 GPa). ... Ключевые слова: Earth's core, iron alloys, carbides, hydrides ...

Еще в разделе: (Показать все результаты (>64) - srcc.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>15) - tukachev.flogiston.ru/ )

• Category: Новости

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>11) - observ.pereplet.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>15) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... Novel Silica Based Sorbents with Polymeric Anion Exchange Layer for Ion Chromatography : .. ... On-line Solid-Phase Extraction ­ Liquid Chromatography Determination of Phthalates and Phenols Based on Extraction on Carbon Sorbent and Desorption by Subcritical Water : , .. ... C Spectrophotometric Determination of Catecholamines Using Gold Nanoparticles. ... Determination of Methylphosphonic Acid in Soils by Reactive High - Performance Liquid Chromatography - Tandem Mass Spectrometry : .. ...

Еще в разделе: (Показать все результаты (>42) - analyt.chem.msu.ru/ )

• Moscow State University: Analytical Chemistry Division

... 2 What is MATLAB ?? Basic Matrix Operations Script Files and M-files Some more Operations and Functions APPLICATIONS: Plotting functions .. ... Vectors are special forms of matrices and contain only one row OR one column. Scalars are matrices with only one row AND one column MATLAB Matrices 17 A matrix with only one row AND one column is a scalar. A scalar can be created in MATLAB as follows: » a_value=23 a_value = 23 MATLAB Matrices 18 A matrix with only one row is called a row vector. ...

Еще в разделе: (Показать все результаты (>9) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf

... Online Services | ... Construct your query and output by sequental openings of needed fields. One output field must be selected (not be blank) at least. ... Query parameters: . Select for output . ... Energy (keV) . ... Y D H M S MS US NS PS FS AS EV KEV MEV or Stable . ... Energy of the ?-ray (keV) . ... Energy parameters of nucleus (B , Alpha energy, N, P separation energy) . ... Neutron separation energy (keV) . Proton separation energy (keV) . ... Excited energy(keV) . ...

Еще в разделе: (Показать все результаты (>25) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• CDFE - Centre for Photonuclear Experiments Data - Home page
• CDFE => Online Services => Nucleus Ground State Parameters

... education . research . ... Fundamentals of Nanotechnology . ... Molecular physiology . ... Pass/fall exam: 5 p.m., 22 May, 2009 (those third-year students who pass the exam undertake further study majoring in Nanosystems and Nanodevices , Functional Nanomaterials , Nanobiomaterials and Nanobiotechnology). ... 10 February 2009 . ... Prof. Yu. ... Work of molecular motors: ATP synthetase, photosynthetic reaction centers, retinal containing photosensitive proteins (rhodopsin, bacteriorhodopsin.) ...

Еще в разделе: (Показать все результаты (>14) - nano.msu.ru/ )

• Fundamentals of Nanotechnology, 2009 | Научно-образовательный центр по