... Asymptotic Frequency-Domain Methods in Modeling Nonlinear Waves with Shocks . ... An abrupt shock has an analytical high frequency asymptote inversely proportional to the frequency. ... The method was generalized later on to include the next asymptotic term responsible for the discontinuity in the first derivative at the shock front; and to account for the finite thickness of the shock using the Fay solution of the Burgers equation for high frequencies. ...

Еще в разделе: (Показать все результаты (>191) - acs366.phys.msu.su/ )

• Abstract (Invited)

Shipunov A.B. Systema Naturae [Electronic resource]. 1995 onwards. ... Pyramid of kingdoms , in SVG . ... Systema Naturae or the outline of living world classification // Protistology. ... The classification has: (1) small number of kingdoms; (2) large phyla; (3) incorporating as much as possible taxonomical data from different sources. ... The classification utilizes all described groups of living organisms, excluding fossils and viruses, from kingdoms and down to the level of class. ...

Еще в разделе: (Показать все результаты (>394) - herba.msu.ru/ )

• Index of /shipunov/school/biol_250
• The flower organ transition in water-lily
• Index of /shipunov/school/biol_154/textbook/pics

Asymptotic behavior of form factor of the composite system at large momentum transfer. ... Comparison of predictions CQM and pQCD for the pion in the Instant form of relativistic quantum mechanics The electromagnetic current matrix element for pion: p | ... Asymptotic behavior of the pion form factor for Q 2 · Pointlike quarks: d d u u GE (Q 2 ) + GE (Q 2 ) = 1, GM (Q 2 ) + GM (Q 2 ) = 1 Ї Ї F (Q 2 ) quarks: 25/2 M - e Q QM 4b 2 1+ 7b2 2MQ . ...

Еще в разделе: (Показать все результаты (>154) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2015/1435297199_SRSamara.pdf
• http://qfthep.sinp.msu.ru/talks2015/1435052353_SerednQFT15.pdf
• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf

Home People Activities Research Publications . ... Containers for image storage in memory, reading and writing of image files, Pipeline filtering library, D.Yurin "On the Images Pipe Line Filtering, PDF , color spaces, fast convolutions, image registration algorithms, edge curvature estimation via differential invariants (under development) , Bresenham algorithms, some numerical algorithms etc. ... Download help on project (CHM) , generated via doxygen (see How to document program's code ) . ...

Еще в разделе: (Показать все результаты (>11) - imaging.cs.msu.ru/ )

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>63) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>4) - tex.bog.msu.ru/ )

• http://tex.bog.msu.ru/rustexeo.html

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>18) - antares.sinp.msu.ru/ )

... Notice: Undefined index: outp in /home/swx/public_html/models/database/modules/db2.php on line 69 Notice: Undefined index: failo in /home/swx/public_html/models/database/modules/db2.php on line 70 Notice: Undefined index: elems in /home/swx/public_html/models/database/modules/db2.php on line 71 Notice: Undefined index: events in /home/swx/public_html/models/database/modules/db2.php on line 72 . ...

Еще в разделе: (Показать все результаты (>1231) - swx.sinp.msu.ru/ )

• SWX - Космическая погода

... Conformational Analysis of Boron-Containing Compounds Using Gillespie-Kepert Version of Molecular Mechanics . ... Abstract - Molecular mechanics force field for boron-containing compounds based on CHARMM parameters and Gillespie-Kepert (GK) model is developed. ... The force field provides an accurate description of experimental X-ray stereochemistries in a wide range of organoboranes, organoborate complexes with polyhydroxy compounds, mixed oligomers of boric acid and borates. ...

Еще в разделе: (Показать все результаты (>32) - analyt.chem.msu.ru/ )

• Study of amino- and pyridyl-containing zinc(II) and cadmium(II) complexes by

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>295) - higeom.math.msu.su/ )

... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

... REVIEWS Measurement and Physical Content of Quantum Information B. A. Grishanin and V. N. Zadkov Received January 15, 2002 Abstract--Basic quantum information measures involved in the information analysis of quantum systems are considered. ... But today, it has become possible to intentionally vary directly quantum states of elementary quantum systems. ... 9 2002 MEASUREMENT AND PHYSICAL CONTENT OF QUANTUM INFORMATION 935 its information-equivalent copy is at the input and output. ...

Еще в разделе: (Показать все результаты (>72) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/LasPhys-2001-11(12)-en.pdf
• http://qilab.phys.msu.ru/papers/LasPhys10_03GrishaninLO.pdf
• Quantum Information Lab, Int'l Laser Ctr. and Faculty of Physics, M.V.Lomonosov

... The name IE2DP1 means: Integral Equation (method of decision), 2D (dimension), P (point current electrodes), 1 - across inhomogeneities. IE2DP1 program fulfills two dimensional (2D) electric field modeling for different modifications of resistivity and induced polarization (IP) field techniques. ... Apparent chargeability is saved always in the file "IE2DP1.RES" and reference point is in current electrode location. ... Number of angular points for one body more than 40 5. ... Run file "start.bat". ...

Еще в разделе: (Показать все результаты (>63) - geophys.geol.msu.ru/ )

• http://geophys.geol.msu.ru/STUDY/manual/ip1dmine.doc
• TES. Modeling example.
• TES. Field example.

... Наука и учеба . ... Публикации . ... Наука . ... 18.03.2016 . ... Главная Наука и учеба Публикации . ... Абстракт: The Shannon information amount corresponding to two independent generalized measurements of all possible quantum states at the input and output is proposed as a natural quantitative characteristic of mutual information stored in two compatible sets of quantum states considered as an input and an output. ...

Еще в разделе: (Показать все результаты (>70) - ofvp.phys.msu.ru/ )

... Randles impedance. Interfacial capacitance. ... Partial currents ik in the bulk solution are determined by transport numbers tk . ... dl Thermodynamics of interfaces ­ binary solution : 2 independent variables, e.g. = +/z+ - -/zsolution: dE+ = ( Cdl )-1 d - t -dl d(/F) d+ = - t+dl d - Cdl d(/F) EDL: + , d- = - t -dl d + Cdl d(/F) metal : THREE independent interfacial parameters: (1) Cdl , interfacial capacitance ( capacitance of the electrical double layer ), (2) t+dl et t-dl , ...

Еще в разделе: (Показать все результаты (>65) - electr003.chem.msu.ru/ )

• Laboratory of Electrochemical energetics

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>90) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

... Book 1 Containing the years from the beginning of the World, or from the year of the Juliam Period 730 unto the third of Solomon, which is the 3702 year of the same Period . ... Book 5 Containing years from the first of CHRIST to the Thirty fourth . Book 6 Wherein are contained the years from the 304 of CHRIST unto 491 . Book 7 Wherein are contained the years from the 491 of CHRIST unto 641 . Book 8 Wherein are contained the years from the 641 of CHRIST unto 1100 . ...

Еще в разделе: (Показать все результаты (>86) - hbar.phys.msu.ru/ )

• The jump of the second derivative of the moon's elongation

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>84) - textbook.sinp.msu.ru/ )

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...