... Re: may someone tell me how to write the following sentences in russia [ re: CAnEP ] . ... Re: may someone tell me how to write the following sentences in russia [ re: nu3geTC ] . ... Re: may someone tell me how to write the following sentences in russia [ re: DizzyDen ] . ... Re: may someone tell me how to write the following sentences in russia [ re: Spring ] . ...

Еще в разделе: (Показать все результаты (>5663) - www.fds-net.ru/ )

... Now let us consider that damping or amplitude of the signal like a natural index of a hypothetical inequality or mean between the action and reaction, or the kinetic and the potential energy of the system. The time between the action and the reaction must be different from zero. ... We can describe this behaviour in its simpler form by the oscillation of a balance with inertiality or sensitivity, that is to say, with a time of reaction for the operations of adding or removing weights. ...

Еще в разделе: (Показать все результаты (>383) - chronos.msu.ru/ )

• Gus Koehler. Useful Hints for Reordering the Universe
• Rational Fertilization of Fish Ponds Populated by Different Species
• Laboratory-chair of Discrete mechanics on a microscopic scale

... Supercomputer molecular modeling of thermodynamic equilibrium in gas-metal microsystems" . Podryga V.O., Polyakov S.V., and Puzyrkov D.V. This paper is devoted to the supercomputer modeling of thermodynamic equilibrium in microsystems containing different substances in various aggregate states. ... Podryga V.O. тАУ Keldysh Institute of Applied Mathematics, Russian Academy of Sciences; Miusskaya ploshchadтАЩ 4, Moscow, 125047, Russia; Ph.D., Scientist, e-mail: pvictoria@list.ru . ...

Еще в разделе: (Показать все результаты (>229) - num-meth.srcc.msu.ru/ )

• "Wavelet crosscorrelations of two-dimensional signals"
• "Correction of solar dopplergrams' large-scale flatfield"
• "Shock waves in real gases with different specific heat ratios ahead of and

GATC avoidance in bacteria with DpnI/DpnII complementary R-M systems A.S. Ershova, 1 2,3,4 I.S. Rusinov,1 A.S. Karyagina, 2,3,4 S.A. Spirin, 1,2,5 A.V. Alexeevski 1,2,5 Lomonosov Moscow State University, Faculty of Bioengineering and Bioinformatics, Physical and Chemical Biology, Moscow 119992, Russia; 3Gamaleya Institute of Epidemiology and Microbiology, Moscow 123098, Russia; 4Institute of Agricultural Moscow 119992, Russia;2Lomonosov ... Computational DNA sequence analysis. ...

Еще в разделе: (Показать все результаты (>275) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/227.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/121.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/115.pdf

... 4 def __init__ ( self , width = 150 , height = 70 , states = None ): . 5 self . ... 9 State ( "Alive" , '+' , "black" , '1' , [ 0 , 1 ] + range ( 4 , 9 ))] . ... 18 for row in range ( height ): . ... 20 for col in range ( width ): . ... 25 for row in range ( 1 , self . ... 26 for col in range ( 1 , self . ... append (( row , col )) . ... append (( row , self . ... 70 for row , col in [( 0 , 0 ), ( self . ... 74 for vert_long in range ( row + self . ... 76 for horiz_long in range ( col + self . ...

Еще в разделе: (Показать все результаты (>14140) - kodomo.fbb.msu.ru/ )

• cca: automata.py annotate
• Index of /FBB/year_06/term1/Pr_7/Examples
• snake: 954cc2774637 snakes/example.snake

... Next: It(Z) tab (STM mode), Up: Scan parameters Previous: Scan parameters Contents Index . On this tab user can set scan parameters corresponding to surface scanning Z(X,Y). ... Scanning mode can be set using falling list that is in upper part of the tab window . ... Steps/lines -- number of points in a scan line and number of lines in surface image. ... On the Litography tab user can choose Mask image , litography mode and parameters for probe-sample interaction during lithography process. ...

Еще в разделе: (Показать все результаты (>127) - www.spm.genebee.msu.ru/ )

• Image formation and processing methods
• Changing Image Resolution
• Average slope subtraction

... Further processing Only 3N events of «good» runs of previous analysis are selected: 3N triggered events exist in every run Better accordance with MC for rates 150kHz (see elog 548 by Colas) GC triggered events excluded AaFit: -6.5 (Vladimir's presentation explains reason) Zenith angle 20° (in order to look only at events with vertical tracks) After 2008 2009 2010 all fi year year year ltres: -- 0.83107 -- 0.77107 -- 1.04107 - No evidence of possible anisotropy either. ...

Еще в разделе: (Показать все результаты (>19) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf

... What does people think about in my country? ... Some Situations are roots in communism, other are new situations created after 1990. ... In this very moment we have many private schools initiated and supported by many different ONG's. Changing the character of education . ... In Romania we need a different education system, one that is supported by society. ... The ramifications of educations system, based on the needs and the development of the economy as well as social and cultural life, go on. ...

Еще в разделе: (Показать все результаты (>90) - www.prof.msu.ru/ )

• Conflict Transformation, Ngo And Networking
• NGOs: The Carriers of Globalization?
• Internationalizing Education In Barnaul State Pedagogical University

... There is a distinction between buried soil and paleosol, even though the two overlap considerably. ... On the other hand, pre-Holocene paleosols in my area (southeastern Minnesota) don't look like buried soils, and are never recognized as such except by specialists. ... By this criterion, the pre-settlement alluvial soils of southeastern Minnesota are borderline paleosols, where they have been buried by sediments eroded from plowed fields. ...

Еще в разделе: (Показать все результаты (>165) - www.fadr.msu.ru/ )

• Abstracts
• REPORT ON INTERNATIONAL SOIL SCIENCE CONGRESS (Montpellier, France, August...
• Herbicide sensitivity of different species

The Converter of Measurement Units is aimed to converting of measurement units between different systems of measurement, for example from British-American units of measurement to metric system and vice versa. To convert a value . ... On the left panel list select a measure you want to convert . ... Select the measurement unit you want to convert from . ... Select the measurement unit you want to convert to . ... Result is displayed in the "Conversion Result" area. ...

Еще в разделе: (Показать все результаты (>13) - sbmg.geol.msu.ru/ )

HUMANITARIAN ASPECTS OF TEACHING MATHEMATICS IN HIGHER SCHOOL Positselskaya L.N. (Moscow) There are considered goals of survey course on mathematics in higher school, its role in building up the scientific world outlook. It is pointed out the importance of analyzing of interdisciplinary connections of mathematics with other branches of knowledge. There is proposed general approach to programs f survey courses on mathematics for different specialities. ... 10, 2002, .137-139 , . ... 1.1 . ...

Еще в разделе: (Показать все результаты (>207) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc27610/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc153984/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc62362/eng.pdf

. Some individual experimental Cerenkov light LDF fits. Experimental pulse example. Differential energy spectrum. Tunka-25 energy spectrum among some other experimental data. Mean depth of EAS maximum with two different methods. EAS maximum depth distributions for two energies. Open histograms - experiment. Filled histograms - simulation for QGSJET-01 and complex composition.

Еще в разделе: (Показать все результаты (>15) - dbserv.sinp.msu.ru/ )

• 3d Map Description
• 1d Map Description

e-mail: viverhovin@yandex.ru) , , , corruption, the western enforcement system, corruption scandals, statistics of corruption in the western countries . ... Analysis and criticism of some apologetics examples of the western market society, not capable to minimize corruption at different levels of its organization is given. Necessary statistical and actual arguments in favor of the author's viewpoint are resulted. ...

Еще в разделе: (Показать все результаты (>44) - vestnik.socio.msu.ru/ )

... CENTRE FOR PHOTONUCLEAR EXPERIMENTS DATA . Online Services | Partners | ... Contacts | ... CDFE: Online Services . Inverse Geometry gives to one the possibility to obtain the data for different reactions with the same combination of incident particle and target nucleus, for example . ... in one request and for energy recalculated from LAB-system to SCI-system . ... If you have any questions, comments, and/or suggestions, please, contact . CDFE Head : Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>26) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• CDFE => Online Services => NSR Search Engine

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... I mean the following Theorem If any local eld (x) is irreducible and [ (x), (y )] = B (x - y ), (1) then operator B (x) is multiple of unit operator, that is (x) is an asymptotic eld. ... Our result is most interesting in the case of noncommutative theory, precisely, in the case of space-space noncommutativity, in which time commutes with spatial variables and, as a consequence, one spatial variable, say x3, commutes with others. ... For simplicity we consider the case of neutral scalar elds. ...

Еще в разделе: (Показать все результаты (>149) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2011/Libanov_Neutrino.pdf
• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf
• http://qfthep.sinp.msu.ru/talks2015/1435258212_Krutov_Polezhaev_Troitsky1_2015.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>74) - geophys.geol.msu.ru/ )

• TES. Field example.
• Anis. Page2
• TES. C-effect

О лаборатории . ... Лаборатория теоретической биофизики . ... The manual to FireFly program clearly explain why and how to use spherical or cartesian functions when working with different basis sets. ... The $D5 group provides further control through the D5, F7, and G9 keywords, which pertain to d, f, and g functions, respectively. ... Quantum chemistry information page ERG Research Group: Лаборатория теоретической биофизики написал (Май 19th, 2015 5:52 пп) . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>57) - erg.biophys.msu.ru/ )

• Python membrane generator for MD simulations ERG Research Group: Лаборатория
• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория
• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики

Chemical differentiation of products of crushing by the grain-size fractions: example of Kovdor magnetite ore . ... The sample was crushed in an iron mortar and divided into the grain-size fractions: +1 mm, -0.5+1 mm and -0.5 mm. ... The chemical compositions of grain-size fractions after the crushing of one sample of a magnetite ore. ... The coarsest fraction is enriched in iron, alumina, titanium and zinc (mainly concentrated in magnetite) and also in phosphorous (mainly concentrated in apatite). ...

Еще в разделе: (Показать все результаты (>515) - geo.web.ru/ )

• http://geo.web.ru/conf/alkaline/2009/Savatenkov.htm
• http://geo.web.ru/conf/alkaline/2009/Savva_Belyatsky.htm
• http://geo.web.ru/conf/alkaline/2009/Sokolov.htm