. Strict Standards : Only variables should be assigned by reference in /storage0/www/http/fengoffice/environment/classes/debug/BenchmarkTimer.class.php on line 273 . Strict Standards : Only variables should be assigned by reference in /storage0/www/http/fengoffice/environment/classes/debug/BenchmarkTimer.class.php on line 297 . Забыли пароль . E-mail адрес: . Выслать пароль ( Вход ) .

Еще в разделе: (Показать все результаты (>2) - aesc.msu.ru/ )

International Laser Center of MSU . Home . ... Education . ... Grants . ... 06.10.2014 . October 10, 2014 . 15:00 S.A. Akhmanov Hall, KNO . ... 20.09.2009 . 3-d International Laser Graduate School "Modern Problems of Laser Physics LGS-2009 " . Moscow Vyatichi, November 9 - 11, 2009. ... March 21, 2014 . 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... Home Research Grants . ... 2009 ILC MSU Made in: Sebekon IT Solutions . ...

Еще в разделе: (Показать все результаты (>98) - ilc.phys.msu.ru/ )

... Abstract A. V. Dmitriev, A. V. Ivanov, A. R. Khokhlov, Numerical simulation of light propagation through a diffuser, Fundamentalnaya i prikladnaya matematika, vol. 15 (2009), no. 6, pp. ... In this article, the light propagation in a diffuser with optically soft inclusions is described with the help of the Fokker--Planck equation, i.e., a transfer equation with a diffusion term in the space of radiation propagation directions. ... 8, 9] , x1 , : 1 D = (3 - x1 ), 6 3 x1 = 2 d x( )cos sin . ...

Еще в разделе: (Показать все результаты (>15) - lizard.phys.msu.su/ )

Zebra : web-server for bioinformatic analysis of large protein superfamilies to identify variable amino acid residues responsible for functional diversity Dmitry Suplatov, Evgeny Kirilin, Vakil Takhaveev, Vytas Svedas Lomonosov Moscow State University, Belozersky Institute ... Zebra has been applied to study how lipase and amidase catalytic activities are implemented into the alpha-beta hydrolase fold. ... Greek letters represent different functional classes within the family. ...

Еще в разделе: (Показать все результаты (>148) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/143.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/248.pdf
• MCCMB'15

Geophysical Research Abstracts, Vol. 5, 01966, 2003 c European Geophysical Society 2003 THE ORIGIN AND COMPOSITION OF PRIMITIVE MELTS OF KLYUCHEVSKOY VOLCANO, KAMCHATKA - INSIGHT FROM MELT INCLUSIONS STUDY N. Mironov (1), M. Portnyagin (1,2), P. Pletchov (3) (1) Vernadsky Institute of Geochemistry and Analytical Chemistry, Moscow ... Average composition of the melts is (in wt.% ... Minimum CO2 content was estimated to be 0.4 wt.% from the density of CO2 U rich fluid inclusions in olivine Fo88. ...

Еще в разделе: (Показать все результаты (>521) - geo.web.ru/ )

• http://geo.web.ru/~sgt/meeting/2001/2001_zonen/circ_1-5_eng_spb.doc
• KRANTZ, THE OLDEST MINERAL DEALER IN GERMANY,
• Abstract

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• NPG-explorer

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>13) - comphep.sinp.msu.ru/ )

• extra:main [CompHEP]

... Original Russian Text Copyright c 2001 by Grigoryan, Mailybaev On the Weierstrass Preparation Theorem S. S. Grigoryan and A. A. Mailybaev Received May 22, 2000 Abstract--An analytic function of several variables is considered. ... As an application, an explicit formula describing a bifurcation diagram locally up to second-order terms is derived for the case of a double root. Key words: Weierstrass preparation theorem, analytic function of several variables, bifurcation diagram. ... ЗЗЗ hn ! ...

Еще в разделе: (Показать все результаты (>29) - mailybaev.imec.msu.ru/ )

• http://mailybaev.imec.msu.ru/papers/KuznetsovEtAl2008.pdf

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>3) - oc.cs.msu.ru/ )

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

... The Department of Operations Research . April 9, 2016 . Welcome Traditional topics of the conference Important dates Abstracts Registration . Final program Accommodation Program committee Organizing committee . ... Moscow, April 10-14, 2007 Abstracts . ... An abstract should be prepared in MS Word according to the attached template. ... Abstracts should be sent by e-mail to io@cs.msu.su in an attached file. ... Accepted abstracts will be published in proceedings of the conference. ...

Еще в разделе: (Показать все результаты (>14) - io.cs.msu.ru/ )

• Registration - ORM 2007

... Symposium expenses . ... Abstract submission . ... 14 European Symposium on . Gas Phase Electron Diffraction . ... The deadline for abstract submission is 20 April, 2011. The abstracts have to be sent to the Symposium web address:  ed.mos2010@gmail.com .  ... Arial font and single spacing should be used throughout. The title should be centered and set with 14-point bold font style. ... The main body of text should be fully justified and set in 12-point regular font style. ...

Еще в разделе: (Показать все результаты (>14) - ged.chem.msu.ru/ )

• Important deadlines. 14 European Symposium on Gas Phase Electron Diffraction

О кафедре . ... Динамические задачи теории упругости . Динамика пластин и оболочек . ... Методы теории упругости . ... Нелинейная теория упругости . ... Пластины и оболочки . ... Теория и расчет оболочек тонкостенных летательных аппаратов . ... Теория упругости структурно-неоднородных тел . ... Уравнения изгиба пластин классическая линейная теория. ... Колебания пластин. ... Oscillation of plates . ... МГУ им. М.В.Ломоносова, механико-математический факультет, кафедра теории упругости . ...

54. Visualize partial charges in PyMol ERG Research Group: Лаборатория

55. http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt2_MATLAB_Workshop_SHORT.pdf

56. Board of directors | depozitariy

57. View publication | Laboratory of Mathematical Methods of Image Processing

58. Corporate Social Policy as an Approach to Managing the Workforce: Some Examples

59. Nhunt: program for nucleic acid sequence similarity search

60. http://ani.cmc.msu.ru/files/geo-2009-lect-02.pdf