Described below are two methods for preparing input files with basis sets and ECPs which are not currently built in. ... Put basis sets and ECPs in directories (called here def2_svp_BAS and def2_ecp_ECP but you can call them whatever you want) and copy them to the Firefly directory. ... Both methods can also be used for preparing gamess (us) files - the check runs may not terminate properly due to certain keywords, but a useable file called 'input' is normally generated. ...

Еще в разделе: (Показать все результаты (>50) - classic.chem.msu.su/ )

• Potential Energy Surfaces with PC GAMESS/Firefly
• How to run Firefly under Linux?

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... Unless in many other approaches to the analysis of different signal coupling, the information entering the analysis of synchronization in our approach is explicitly represented in the form of elementary, instantaneous events (the change-points). ... Hence the use of correlation/coherency estimates in parallel with change-point analysis seems to be quite rational. ...

Еще в разделе: (Показать все результаты (>35) - brain.bio.msu.ru/ )

• Change-points at different levels of the hierarchy of EEG segmental...
• Change-points in EEG components with different pattern

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>101) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• AliComp - GeneBee Alignments Comparison - Advanced
• BLAST Frequently Asked Questions (FAQ)

Thursday, June 24th, 2010 . ... Wednesday, June 16th, 2010 . На сайт добавлен пакет Lightbox 2.04 (http://www NULL .huddletogether NULL .com/projects/lightbox2/) (by Lokesh Dhakar) для отображения графики с дополнительными визуальными эффектами: . ... You are currently browsing the Лаборатория лазерной интерферометрии blog archives for June, 2010. ... Наши публикации . ... Публикации за 2011 . Публикации за 2012 . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>4) - geo.sai.msu.ru/ )

• Lightbox 2 Лаборатория лазерной интерферометрии
• site lightbox Лаборатория лазерной интерферометрии
• Uncategorized Лаборатория лазерной интерферометрии

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>64) - imaging.cmc.msu.ru/ )

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>3) - www.sciencepark.ru/ )

• MSU Science Park - Venue & Space

ChangeLog for snakes # # Generated by Trac 0.12.5 # 04/11/16 22:55:00 Mon, 20 Dec 2010 14:01:39 GMT Daniil Alexeyevsky me.dendik@тАж [134:8e75e931bfd2] * snakes / example.snake ( modified ) example.snake : better rules for chasing enemy tail Mon, 20 Dec 2010 11:57:44 GMT Daniil Alexeyevsky me.dendik@тАж [121:06e4b4ea7596] * snakes / example.snake ( modified ) * ...

Еще в разделе: (Показать все результаты (>383) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=360c297c05f3577ca730ecaf86131163456f6b73&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=138%3A416418c9aaef&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=416418c9aaefbd75f3451a63f12d0ab8af3b89f3&limit=100&mode=stop_on_copy

... It has also been the subject of a number of theoretical projects concerning how zygotic expression is controlled by maternally-derived spatial signaling gradients, in particular how hb is activated by the Bicoid (Bcd) gradient. ... By optimizing the model to Hb expression data (constrained by experimental data for regulatory TFs), we found parameter sets which produced robust hb expression despite high variability in maternal input factors (Bcd and maternal Hb (Hb mat )). ...

Еще в разделе: (Показать все результаты (>91) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/121.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/23.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/8.pdf

Lessons learned from the Thirty Meter Telescope site testing Tony Travouillon Sebastian Els, Angel Otarola, Reed Riddle, Matthias Schoeck, Warren Skidmore TMT.XXX.PRE.05.0XX.DRF01 1 Introduction TMT and its Site testing. Important choice before going on site. ... Considerations during analysis of the data. TMT.XXX.PRE.05.0XX.DRF01 2 Some Background about the TMT Site Testing TMT is a 30m, segmented, RitcheyChretien telescope design. ... ASCA Cloud Cover Analysis So how do we do it in practice? ...

Еще в разделе: (Показать все результаты (>13) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/OVoziakova_site2010.pdf.pdf

... Alechin , Vasilii Vasilievich (1884-1946) . Alexeev , Eugeni Borisovich . Bobrov , Andrej Evgenievich . ... Ehrhart , Friedrich (1742-1795) . Goldbach , Carl Ludwig (1793-1824) . ... Juzepczuk , Sergei Vasilievich (1893-1959) . Karavaev , Mikhail Nikolaevich ( 1903-1992 ) . Khokhrjakov , Andrej Pavlovich (1933-1998) . Kuvaev , Vladimir Borisovich . ... Linnaeus , Carl, fil. ... Sokoloff , Dmitry Dmitrievich . ... Tzvelev , Nikolai Nikolaevich . ... Phone/fax: 7 (095) 939-2777 . ...

Еще в разделе: (Показать все результаты (>82) - herba.msu.ru/ )

• INTERNATIONAL SYMPOSIUM
• Alders in the European Russia
• The employment of quantitative methods for the lake ecosystem research

. Moscow State University . INTERNATIONAL CONFERENCE . H YDRODYNAMIC I NSTABILITY AND T URBULENCE . February 24 ? March 02 , 2008 . Moscow, Russia . Call For Papers Информационное письмо . Author instructions . Abstract example Paper example . Location (More information) . Conference Program Posters . E-mail : gertsens@imec.msu.ru . Institute of Mechanics, Lomonosov Moscow State University . Aerodynamical Installations . Moscow Sights & Attractions

Еще в разделе: (Показать все результаты (>9) - hit-conf.imec.msu.ru/ )

. ? mfs = 0.7 cm . ? hsfa = 0.8 cm . D sun_slit = F ? (2?) [rad] [cm] . (F mfs = 13500 mm, F hsfa = 35000 mm) . A procedure for calibrating fits images from Ondrejov Multichannel Flare Spectrograph .

Еще в разделе: (Показать все результаты (>91) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR
• IDL programs
• FITShdr: INSTALL

... Русский English . Background . ... The Faculty of Bioengineering and Bioinformatics, Lomonosov Moscow State University was founded in 2002 with the express purpose of training of highly qualified personnel for the universities, research institutes, medical companies and facilities, and pharmaceutical and biotechnology industries. ... Each of FBB students is to successfully complete and defend three yearly research projects, in bioinformatics, biochemistry, and bioengineering. ...

Еще в разделе: (Показать все результаты (>10) - en.fbb.msu.ru/ )

• Faculty of Bioengineering and Bioinformatics, Lomonosov Moscow State University
• Site map? Faculty of Bioengineering and Bioinformatics, MSU

... The 1973 eruption on the island of Heimaey is a classic example of the struggle between man and volcanoes. With a heroic effort the people of Iceland saved the town of Vestmannaeyjar and the country's most important fishing port. ... The island of Heimaey with the growth of the island in 1973, the location of the eruptive fissure, and the location of Eldfell, the 1973 cone. ... View of Heimaey before the eruption. ... Eldfell and the 1973 lava flows are just beyond the town. ...

Еще в разделе: (Показать все результаты (>167) - geo.web.ru/ )

• Все о геологии :: ChemEl 1.0
• Публикации
• Spectrum of Heterogeneity

Wavelet Analysis of E852 Experimental Data V. L. Korotkikh  and L. I. Sarycheva   Scobeltsyn Institute of Nuclear Physics, Moscow State University, Moscou 119899, Russia Abstract. A calculation of background in the hp 0 mass spectrum by the wavelet analysis is presented. ... A large final state statistics of E852 experiment [4, 5, 6] in the p p interactions at 18 GeV/c allows to use the wavelet analysis both for one­dimensional and for two­ dimensional distributions. ... are built (fig. ...

Еще в разделе: (Показать все результаты (>30) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/~vlk/report_E852.ps

Название статьи И.О. Фамилия11,a, И.О. Фамилия22,b 1 Название института и полный адрес, например: Московский государственный университет имени М.В.Ломоносова, физический факультет, кафедра общей физики. ... Title in English I.O. Pervyiavtor1,a , I.O. Vtoroiavtor2,b 1 Название института и адрес на английском языке, например: Department of [.. ... Moscow 119991, Russia. 2 Название института и адрес на английском языке, например Sternberg State Institute of Astronomy, Moscow State University. ...

57. Gus Koehler. Useful Hints for Reordering the Universe

58. Public administration. Web journal

59. XAFS Publication Database search form

60. http://acat02.sinp.msu.ru/presentations/vaiciulis/acat2002.ps