. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>18) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1359) - kodomo.cmm.msu.ru/ )

• examples.zip тАУ Cyclyc Cell Automata
• WikiRestructuredText тАУ Tanchiki
• WikiProcessors тАУ Tanchiki

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: on the will example, refine wealth, the a . ... a href=http://celineforyou.zohosites.com/><b>Celine bags</b></a> As we all know, buy things online maybe cheaper than absolute shopping, so abounding women like online shopping. ... http://www.isabelmarantmybest.com . ...

Еще в разделе: (Показать все результаты (>2302) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: shall year June best example,
• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.
• Экологический Форум - Фундаментальная Экология: center China. the example, the

... О UNИX . ... Examples . ... 1 s = raw_input () 2 repeat = 0 3 for i in xrange ( 1 , len ( s )+ 1 ): 4 found = 1 5 for k in xrange ( 1 , len ( s )/ i ): 6 equal = 0 7 for j in xrange ( i ): 8 if s [ j ]== s [ j + i * k ]: 9 equal += 1 10 if equal == i : 11 found += 1 12 if found * i == len ( s ): 13 if repeat < found : 14 repeat = found 15 print repeat . ... LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples (последним исправлял пользователь PavelSutyrin 2014-11-05 12:16:59) . ...

Еще в разделе: (Показать все результаты (>206) - uneex.mithril.cs.msu.su/ )

• HelpOnSessions - UNИX
• Index of /static/GimpDoc_EnRu/images/dialogs/examples
• HelpOnMoinCommand/ExportDump - UNИX

Astronomy Picture of the Day . ... Showing all the trails as complete circles, such an image could be achieved only from two places on planet Earth . ... Directly overhead in the faint constellation Octans is the projection of Earth's rotational axis , the South Celestial Pole , at the center of all the star trail circles. Not so well placed as Polaris and the North Celestial Pole, the star leaving the small but still relatively bright circle around the South Celestial Pole is Beta Hydri . ...

Еще в разделе: (Показать все результаты (>3316) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• High Noon Analemma Over Azerbaijan
• NGC 5307: A Symmetric Planetary Nebula

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>137) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPsite - Algorithm Format requirements
• User's guide

Implementation of vectorized finite-difference algorithms for solving boundary value problems of fluid and gas mechanics with MATLAB package" . Volkov K.N., Emelyanov V.N. An approach to organization of vectorized computations and implementation of finite-difference methods for solving boundary value problems of fluid and gas mechanics with MATLAB package is considered. ...

Еще в разделе: (Показать все результаты (>265) - num-meth.srcc.msu.ru/ )

• "Bayesian network prediction: algorithm and software implementation"
• "A general approach to the implementation of methods for the implicit surface
• "Application of a control-volume method for solving the problems of two-phase

... help . ... blocks3d/wt: use vector instead of list as container for tasks Actions are needed from this container: * remove_if * size * push_back list should have constant size(), but it has linear size in some implementations (for example, in g++). author . ... 2 import subprocess . 3 import os . 4 import shlex . 5 import optparse . ... add_option ( '-n' , '--size' , type = int , help = 'Pool size' ) . ... add_option ( '-c' , '--cmd' , . ... 14 spawned = 0 . ... 16 if spawned > options . ...

Еще в разделе: (Показать все результаты (>11626) - kodomo.fbb.msu.ru/ )

• Index of /FBB/year_06/term1/Pr_7/Examples
• allpy: utils/pool annotate
• snake: 954cc2774637 snakes/example.snake

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>445) - zmmu.msu.ru/ )

• XIV International Ornithological Conference of North Eurasia: Abstracts

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>64) - hist.msu.ru/ )

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... Comments Example comment topic for CommentPluginExamples "return" Target comment output 1 Main.ProjectContributor 03 Dec 2006 Target comment output 2 Main .. NEW - 27 May 2010 - 20:28 by ProjectContributor . ... NEW - 08 Feb 2009 - 04:38 by ProjectContributor . ... GenPDFAddOn Child Topic Header Level 2 This is a First level child below the PDF Demo topic. ... NEW - 06 Jan 2010 - 21:11 by ProjectContributor . ... Foswiki's Sandbox web . NEW - 13 Aug 2010 - 02:06 by ProjectContributor . ...

Еще в разделе: (Показать все результаты (>2157) - wiki.cs.msu.ru/ )

• YahooUserInterfaceContrib < System < Foswiki
• IncludeTopicsAndWebPages < System < Foswiki

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>262) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round
• Moscow University Chemistry Bulletin Vol. 52, No. 1, P. 36 (2011)

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>54) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• SCOP famyli: DNA-binding protein LAG-1 (CSL)

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>14) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE => Online Services => NSR Search Engine
• CDFE provides the major photonuclear databases. Online Services.

... public class ExtensionFileFilter . ... A convenience implementation of FileFilter that filters out all files except for those type extensions that it knows about. ... Extension - create a new filter that filerts out all files but gif and jpg image files: JFileChooser chooser = new JFileChooser(); ExtensionFileFilter filter = new ExtensionFileFilter( new String{"gif", "jpg"}, "JPEG GIF Images") chooser.addChoosableFileFilter(filter); chooser.showOpenDialog(this); . ... private java.lang.String . ...

Еще в разделе: (Показать все результаты (>58) - angel.cs.msu.su/ )

• : Package ucar.multiarray
• Appendix D NetCDF 2 C Transition Guide
• : Package ucar.netcdf

... 2015 . ... Administrative problems: theory and practice . ... Kudeev А.S., Tsilosani A.I. Implementation of corporate housing motivation programs through public-private partnership . ... Vasilyeva E.V. Problems of Regional Social and Demographic Management . Communication management and strategic communication in public administration . ... Communication Aspect of Terrorism and Counter-Terrorist Activities in Italy (2000-2012) . ... Legal and political aspects of public administration . ...

Еще в разделе: (Показать все результаты (>146) - ee-journal.spa.msu.ru/ )

All Firefly versions can take optional command line arguments. ... firefly [optional command line options in any order] [optional list of working directories] . ... The list of most widely used command line options is given below: . ... Disables validity check of the command line arguments (e.g., check for valid names of files and directories, etc...) passed to Firefly. ... However, if this option is not given, one must provide the list of working directories when running Firefly in parallel mode. ...

Еще в разделе: (Показать все результаты (>74) - classic.chem.msu.su/ )

• Lesson 3: two methods for preparing Firefly' input files with basis sets and
• Potential Energy Surfaces with PC GAMESS/Firefly
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>5) - www.sciencepark.ru/ )

• MSU Science Park - Venue & Space

Примеры из книги О.Д.Авраамовой . ... 5_2.WRL Повторное использование объектов (лучше смотреть с отмеченной опцией "wireframe rendering" браузера, поскольку сфера находится внутри куба и обычным образом видна не будет) . 6_1.WRL Эллипсоид вращения (пример использования узла Transform) . ... 8_2.WRL Пример иллюстрирует использование вариабельности разных полей узла Material. ... Для того, чтобы пример работал и на вашем локальном диске, не забудьте скопировать файл 12_3.WRL . ...

Еще в разделе: (Показать все результаты (>6) - www.srcc.msu.ru/ )