Sorex araneus . Temporal and spatial distribution of Rad51 protein in spermatocytes of the common shrew Sorex araneus L. (Soricidae, Eulipotyphla) . ... We used antibodies against human Rad51 to examine the temporal and spatial distribution of Rad51 in the spermatocytes of the common shrew Sorex araneus (Eulipotyphla, Soricidae). ... Synaptonemal complexes of the common shrew Sorex araneus L. in spermatocyte spreads // Cytogenetics and Cell Genetics. ... Chromosomes of the common shrew // Nature. ...

Еще в разделе: (Показать все результаты (>1381) - zmmu.msu.ru/ )

• Distribution of the stone marten Martes foina (Carnivora, Mustelidae) in the
• Present distribution of Pipistrellus kuhlii in the Volga region
• Analysis of wild boar (Sus scrofa L., 1758) distribution in Northeast of

... Obtaining and Unpacking the Distribution . ... mpich can be obtained by anonymous ftp from the site info.mcs.anl.gov . ... uncompress mpich.tar.Z tar xvf mpich.tar This will create a single directory called mpich , containing in various subdirectories the entire distribution, including all of the source code, some documentation (including this Guide ), man pages, the mpich environment described in Section The
 mpich
 Programming Environment , and example programs. ... Центры . ...

Еще в разделе: (Показать все результаты (>248) - www.parallel.ru/ )

• Distributed Array Datatype Constructor | PARALLEL.RU -
• MPI_Group_compare | PARALLEL.RU - Информационно-аналитический центр по
• MPI_Comm_compare | PARALLEL.RU - Информационно-аналитический центр по

... One of the most widely used tools of Fourier analysis is the Parseval theorem. It enables the experimentalist to view how the `energy' in the signal is distributed among frequencies. The Fast Fourier Transform (FFT) algorithms have made power spectra one of the obvious diagnostics tools during data acquisition, and energy maps are a versatile alternative. ... The result is an energy map (Fig. 9), showing the distribution of energy corresponding to the wavelet map (Fig. ...

Еще в разделе: (Показать все результаты (>2686) - crydee.sai.msu.ru/ )

• Image: Nijo castle, Shogun palace. The main building. Comparing to temples and
• Relationship Between Auto Chirplet FF Plane and Radon Transform
• Installing the System

How do Linux Threads compare with other OSs'? ... Solaris . ... Priority Scheduling [1] . ... Mutex Attributes . ... Thread Attributes . ... Posix and Solaris link thread priorities with mutexes and use the priority of a blocked thread's mutex to alter the priority of the blocking thread. Win32 and Linux let the scheduler determine what thread to elevate in priority. ... Solaris implements it because they need it: the program can change certain thread's attributes unless it is suspended. ...

Еще в разделе: (Показать все результаты (>515) - rtm-cs.sinp.msu.ru/ )

• Objects in distributed systems

Next: Building sendmail.cf Up: Installing sendmail Previous: Installing sendmail . First, you have to unpack the archive file in some safe location: . If you have a ``modern'' tar, for example from a recent Slackware Distribution, you can probably just do a tar -zxvf filename.tgz and get the same results. Unpacking the archive creates a directory named sendmail5.65b+IDA1.5+mailx5.3b. In this directory, you find a complete installation of sendmail+IDA plus a binary of the mailx user agent. ...

Еще в разделе: (Показать все результаты (>254) - itpm.msu.su/ )

• Mixing and Matching Binary Distributions
• A Gentle Introduction to Taylor UUCP
• MySQL Reference Manual for version 3.23.10-alpha. - 21 How MySQL compares to

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... A. , Degtyaryev V. , Tomkovich P. , Tracy D. , Koivula K. в журнале Diversity and Distributions , издательство Blackwell Publishing Inc. ... в журнале Diversity and Distributions , издательство Blackwell Publishing Inc. ...

Еще в разделе: (Показать все результаты (>1428) - istina.msu.ru/ )

• IET Generation, Transmission and Distribution - журнал | ИСТИНА -
• Compare - журнал | ИСТИНА - Интеллектуальная Система Тематического Исследования
• Murray A.S. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

Introduction to Gymnosperms Group of seed bearing plants that contain conifers, cycads, Ginkgo, and Gnetales. ... The 5 main lineages separated from each other during the late Carboniferous to late Triassic (311-212 mya) While many species such as Ginkgo biloba are living fossils,due to pulses of extinction and specialization most living gymnosperm species are much younger then though to be. ... Due to these climate changes older lineages of gymnosperms are mostly found in the southern hemisphere. ...

Еще в разделе: (Показать все результаты (>149) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_330/2013_2014/presentations/atlantic_dispersal/atlantic_dispersal_presentation.pdf
• http://herba.msu.ru/shipunov/plans/sh-pstr1.pdf
• http://herba.msu.ru/shipunov/school/biol_330/2013_2014/presentations/microorganisms/microorganisms_presentation.pdf

О факультете . ... Психологи МГУ . ... История факультета . ... Совет по психологии УМО университетов РФ . ... Правила приема на факультет психологии МГУ . ... Клуб выпускников факультета психологии МГУ . ... The first issue of the 'Psychology in Russia: State of the Art' yearbook was introduced at the 29th International Congress on Psychology held July 20-25, 2008 in Berlin. ... The 12th European Congress of Psychology. ... The 15th European Conference on Developmental Psychology. ...

Еще в разделе: (Показать все результаты (>109) - www.psy.msu.ru/ )

... THE EFFECT OF CATALYST ON INTERMOLECULAR HETEROGENEITY DISTRIBUTION IN ETHYLENE/1-HEXENE COPOLYMERS . ... Copolymers of ethylene with higher 1-olefins are important class of polymer products due to their specific properties. Ethylene/a-olefin copolymers properties depends not only on the type and amount of the a -olefin comonomer in the polymer but also on its distribution along the polymer chain [1]. ...

Еще в разделе: (Показать все результаты (>88) - www.chem.msu.ru/ )

COMPARISON OF CLUSTERING ALGORITHMS FOR SPEAKER IDENTIFICATION Nikolay Lubimov, Evgeny Mikheev, Alexey Lukin Moscow Lomonosov State University, Moscow, Russia In this paper we consider the problem of text-independent speaker identification that refers to acoustic recognition research. ... We have performed the comparison of different clustering methods for speaker identification: the standard K-means clustering, K-means++, Linde-Buzo-Gray, Fuzzy C-means, and Gustafson-Kessel algorithms. ...

Еще в разделе: (Показать все результаты (>112) - imaging.cmc.msu.ru/ )

... Kiryukhina N.A. Morphological variability of black-striped pipefish Syngnathus nigrolineatus in connection with its invasion into reservoirs of the Volga basin . Kotovskaya A.A., Khristenko D.S. Distribution and some peculiarities of biology of Pseudorasbora parva (Temm. et Schl., 1846) of littoral of Kremenchug reservoir . ... Download Russian Journal of Biological Invasions, 2013, issue ? ... Web-site of Russian Journal of Biological Invasions is developed and supported by the . ...

Еще в разделе: (Показать все результаты (>1972) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Compare Best Deals
• Экологический Форум - Фундаментальная Экология: Compare Prices
• Экологический Форум - Фундаментальная Экология: Price Compare Website

This page briefly describes the texture filtering modes implemented in the current release of PolyWorld Engine. The following is a sample MIP-map texture generated from a regular 256x256 texture map. ... This map is usually referred to as a 4D Pyramid Anisotropic Filtering map. Only one, isotropic integer MIP level is calculated (MIP u = MIP v ). ... Unlike the Bilinear Filtering case shown above, rational isotropic MIP level is calculated . ... color = lrp (color1, color2, frc_MIP); . ...

Еще в разделе: (Показать все результаты (>6) - www.kge.msu.ru/ )

Site navigation: . Home . ... FAQ . ... SPDC Laboratory . Quantum Electronics Chair . ... Site configuration . Home / FAQ / Quantum key distribution / . Error: You currently have Javascript disabled. This website uses Javascript for many elements such as the menus and page customization. Please enable Javascript in your browser for the optimum website experience. This page redirects to: en.wikipedia.org/wiki/Quantum_key_distribution . Site search . ...

Еще в разделе: (Показать все результаты (>78) - qi.phys.msu.ru/ )

... Data . ... Coronas-F . ... Solar energetic particles . ... Particle spectra at LEO . ... Spatial distributions of electrons with the energy 300-600 keV measured onboard CORONAS-F (2004-2005 years) and тАЬUniversitetsky-TatyanaтАЭ (2005-2006 years) satellites. Spatial distributions (geographical map) of trapped, quasi-trapped and precipitated electrons with the energy 300-600 keV measured on board CORONAS-F satellite in evening-night MLT sectors. ...

Еще в разделе: (Показать все результаты (>16) - smdc.sinp.msu.ru/ )

• Particle distribution images (based on data from Coronas-F) - Space monitoring
• Scientific services - Space monitoring data center

... Development of AIG Life products distribution within the partner\'s sales channels to ensure effective sales growth and appropriate quality of business . Plan and implement actions for accounts to deliver the sales targets . ... Insurance or financial retail industry experience . Minimum 1 year sales experience in managing accounts (banking retail preferred) . ...

Еще в разделе: (Показать все результаты (>11) - www.physcareer.ru/ )

... Ivanovo State University . My experience as a Fulbright scholar in the USA gave me an ample opportunity to compare the structure, functions and modes of self-identification in the US and Russian academic communities. Overall, the American university system seemed more flexible and capable of self-adjusting to the demands of the moment. ... Though Russia is far behind the USA in technology and electronic media, we still can adopt some American educational technologies. ...

Еще в разделе: (Показать все результаты (>41) - www.prof.msu.ru/ )

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . 10.2 / . 2009-Dec-06 17:59:27 . - . Directory . lighttpd/1.4.37

Еще в разделе: (Показать все результаты (>18) - curl.sai.msu.ru/ )

. Kudryashov S.I. , Ionov S.G. , Zorov N.B. Mendeleev Communications (in print). Abstract . Fluctuations of mass and charge density of carbon at critical and supercritical states take place in the form of multiply-charged negative and positive nanocluster ions forming a weakly-ionised electronless plasma. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>390) - chem.msu.ru/ )

• Determination of Reaction Rate Constants in Micelles. A Comparison of the
• [На предыдущий раздел]
• Conjunction of thermal lens spectrometry and high-performance liquid

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>114) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services

DVM debugger . Detailed design . ... 1.1 The ?Dynamic control of DVM-directives? method . ... 1.3 The ?Comparing execution results? method . ... 4 Base modules implementation . ... 5 Dynamic control of DVM-directives . ... 5.6 Dynamic control of DVM directive implementation . 5.6.1 Use the table of variables by dynamic control module . 5.6.2 Base functions of dynamic control module . ... 6.5.5 Trace comparing module . ... The messages of dynamic control of DVM-directives . ...

Еще в разделе: (Показать все результаты (>132) - sp.cs.msu.ru/ )

• DVM-system. Goals and structure
• DVM-system. Version history
• C-DVM language description