. Next: Frequency distribution of galactic Previous: Gravitational Wave Sky: An . Frequency distribution of galactic binaries . Structure of the Galaxy . Mike E. Prokhorov . Sat Feb 22 18:38:13 MSK 1997

Еще в разделе: (Показать все результаты (>780) - xray.sai.msu.ru/ )

• Structure of the Galaxy
• The Model
• Frequency distribution of galactic binaries

Laboratories \ Group for Bioinformatics and Modeling Biological Process \ www.sevin.ru Web Portal Functional Possibilities . ... www.sevin.ru Web Portal Functional Possibilities . ... Representation of information (standard technologies of presentation in WEB, plus technologies of data visualization); . ... Portal "Genetic and biological collections of the RF". ... WEB-portal and database of coordinating center on access to genetic and biological collections of the Russian Federation. ...

Еще в разделе: (Показать все результаты (>5745) - www.sevin.ru/ )

• Laboratories: Group for Bioinformatics and Modeling Biological Process: Goals
• Laboratories: Group for Bioinformatics and Modeling Biological Process: Results
• Экологический Форум - Фундаментальная Экология: New model chanel purses

... DRIVER: Using the regional climate model COSMO-CLM for detailed climate changes simulation in the European part of Russia, Arctic, tropical zone etc. STRATEGY: Global climate models don't allow to assess climate changes features on the regional scales reliably. ... IMPACT: Advance in the regional climate modeling quality (European part of Russia, Arctic, tropical zone) at the expense of using the regional model COSMO-CLM. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>43) - hpc.msu.ru/ )

• APPLICATIONS: Inorganic Chemistry | Moscow University Supercomputing Center
• APPLICATIONS: Geology | Moscow University Supercomputing Center
• APPLICATIONS: Fundamental Medicine and Phisiology | Moscow University

... Glossary of the laboratory-chair . ... Institute Laboratory-Chairs . ... Laboratory-chair of modelling the natural references of time . ... All natural systems are considered as hierarchic systems. ... These flows are called generating flows. ... The union of all sets of elements of a system's generating flows is considered as its space or medium. ... The formation, or the course of time, in systems is considered as changing the amount of substance of some generating flows in these systems. ...

Еще в разделе: (Показать все результаты (>1477) - chronos.msu.ru/ )

• O.S.Razumovsky. Models of Time in Physics and Cosmology
• Laboratory-chair of Discrete mechanics on a microscopic scale
• On the Way to Understanding the Time Phenomenon: the Constructions of Time in

... If there's no significant multiple alignment , including the sequence, that you interest, then the secondary structure is built, using only the energy model (just the potential energy of the system is minimized), but very often such method will give unreliable results. ... It should be mentioned that by default, at alignment case, the RNA secondary structure will be predicted for the first sequence of the alignment. ... It is done through optimizing, not the real, but model energy of the structure. ...

Еще в разделе: (Показать все результаты (>263) - www.genebee.msu.ru/ )

• Databases
• baratova_dept

... Master Education . ... Master programs . ... Master program "Mathematical Models of Complex Systems: Theory, Algorithms, Applications" . ... The Mathematical Models of Complex Systems: Theory, Algorithms and Applications Master?s programme is aimed at studying the foundations of computational methods and software for new types of current problems in modelling, decision-making, and control of complex systems. ... Второе высшее образование: second_edu@cs.msu.ru, 6-й этаж, комната 640, тел. ...

Еще в разделе: (Показать все результаты (>116) - hcs.cmc.msu.ru/ )

• Mathematical models and methods in VLSI design | Магистерское и послевузовское

... Астронет | ... NGC 1365: спиральная галактика с перемычкой . ... Перевод: Козырева А.В. Пояснение: Многие спиральные галактики обладают перемычками в центре. ... Публикации с ключевыми словами: barred spiral galaxy - universe - nearby - spiral galaxy - спиральная галактика с перемычкой - Спиральные ветви галактик - звездообразование . Публикации со словами: barred spiral galaxy - universe - nearby - spiral galaxy - спиральная галактика с перемычкой - Спиральные ветви галактик - звездообразование . ...

Еще в разделе: (Показать все результаты (>32917) - www.astronet.ru/ )

• Астронет > Космическая станция в лучах Солнца
• Астронет > Трубчатые облака над Мексикой
• Sudbury Indicates Nonstandard Particle Model

О лаборатории . ... Лаборатория теоретической биофизики . ... For lipid bilayer modelling the whole toolchain was built: from creating membranes to MD trajectory analysis. ... We use OPLS-AA with some includings; ?includings? are overlays on the standart GROMACS forcefield files. ... 4 комментариев " Lipid membrane MD modeling with GROMACS " . Python membrane generator for MD simulations ERG Research Group: Лаборатория теоретической биофизики написал (Февраль 14th, 2012 4:11 пп) . ...

Еще в разделе: (Показать все результаты (>36) - erg.biophys.msu.ru/ )

• gromacs ERG Research Group: Лаборатория теоретической биофизики
• membrane ERG Research Group: Лаборатория теоретической биофизики
• topology ERG Research Group: Лаборатория теоретической биофизики

... Models of Execution . Up: Formalizing the Loosely Synchronous Model Next: Static communicator allocation Previous: Basic Statements . In the loosely synchronous model, transfer of control to a parallel procedure is effected by having each executing process invoke the procedure. ... We say that a parallel procedure is active in a process if the process belongs to a group that may collectively execute the procedure, and some member of that group is currently executing the procedure code. ...

Еще в разделе: (Показать все результаты (>352) - www.parallel.ru/ )

• Model implementation of buffered mode | PARALLEL.RU -
• The MPI-2 Process Model | PARALLEL.RU - Информационно-аналитический центр по
• Formalizing the Loosely Synchronous Model | PARALLEL.RU -

... Contact information . ... 119991, Moscow, GSP-1, Leninskiye Gory, MSU, 2nd Educational Building, CMC Faculty . ... Our goal is to provide researchers from many branches of science, education and industry with innovative tools and methods for solving applied problems using the latest information technologies, modern methods of computation modeling and scientific visualization. ... The uncertainty can be used in further uncertainty estimation of a computational model that uses FetchClimate. ...

Еще в разделе: (Показать все результаты (>143) - en.cs.msu.ru/ )

• Research Laboratory of Computational Modeling Tools
• Laboratory of Industrial Mathematics
• Laboratory of Mathematical Physics | CMC MSU

... Литература . ... 39, 31, 15-26, 1999 Лазутин Л.Л. Рентгеновское излучение авроральных электронов и динамика магнитосферы, Л., Наука, 1979 (также Lazutin,L.L., X-ray emission of auroral electrons and magnetospheric dynamics, Physics and Chemistry in Space, v.14, Springer-Verlag, Berlin-Heidelberg, (1986). ... 34, 227-247, 1996 Akasofu, S.-I. Polar and magnetospheric substorms, Dordrecht-Holland:D.Reidel, 1968. ... J.Geophys.Res. ... 3:321-326, 1996. ... 1996. What is a global auroral substorm? ...

Еще в разделе: (Показать все результаты (>344) - www.kosmofizika.ru/ )

• Index of /model/prepare
• Курс лекций по физике солнечного ветра (для бакалавров) Усманов Аркадий
• Е.Е. Антонова, ч.5 Следы плазмоидов и формирование дисперсных структур частиц в

Официальный сайт кафедры Математической теории интеллектуальных систем и . ... Наука . ... A.B. Zizchenko, A.S. Agjiev, S.P. Konovalov, M.V. Kulagin, P.Pogorelko, V.A. Serebriakov, S.V. Znamenskii The Russian web portal of mathematical resources math-net.ru . ... D.N. Babin To the automata models in the information processing . ... A.V. Chechkin Applied intelligent systems . ... A.V. Sokolov, E.A. Aksenova, A.A. Lazutina, A.V. Tarasyuk Mathematical models of dynamic data structure . ...

Еще в разделе: (Показать все результаты (>205) - www.intsys.msu.ru/ )

... Proceedings 2009 . Proceedings 2008 . ... Proceedings 2004 . ... Design, construction and operation of the magnetic systems of some electrophysical setups require a preliminary mathematical modeling as well as a constant maintenance of mathematical modeling when debugging and operating the setups. ... This work discusses the results on the numerical modeling of the distributing magnetic field for some modifications of the spectrometric magnet SP-94 used in some experimental setups. ...

Еще в разделе: (Показать все результаты (>534) - www.mce.biophys.msu.ru/ )

• Quantum ? chemical functioning model of the ferredoxin iron ? containig cluster
• Heat transfer in non-uniform by structure monodisperse system, containing
• Mathematical modeling of unsteady thermoacoustic interactions in a heated duct

Welcome to the site of the Laboratory of Mathematical Models of Quantum Scattering Processes . ... It develops mathematical models of ionizing collisions in atomic, molecular, and condensed matter physics. Main areas of current research activity include single and multiple ionization by electron, ion, and photon impact, ionization processes in strong laser pulses, and laser-assisted ionizing collisions. ... Research | ... c) Laboratory of mathematical models of quantum scattering processes, 2012 . ...

Еще в разделе: (Показать все результаты (>13) - lmmqsp.sinp.msu.ru/ )

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6978) - mouse.belozersky.msu.ru/ )

• wLake program homepage

... Монобактам (9) - наиболее перспективный представитель моноциклических беталактамных антибиотиков природного происхождения. ... Рассмотрим роль заместителей в различных положениях монобактама в биологической активности производных. Положение N(1). ... Обширный литературный материал по механизмам действия беталактамных антибиотиков и механизмам антибиотикорезистентности позволил провести систематизацию сведений, касающихся взаимосвязи структуры и биологической активности антибиотиков. ...

Еще в разделе: (Показать все результаты (>24350) - www.nature.web.ru/ )

• Первая за последние 10 лет книга по компьютерному моделированию динамических
• Геологические структуры на космических снимках
• Зонная структура электронного энергетического спектра в твердых телах. Модели

.

Еще в разделе: (Показать все результаты (>117) - comet.sai.msu.ru/ )

• The Structure of HTML 3.0 Documents
• List Item
• The Body Element and Related Elements

Block |from|to(exclusive)|gaps 0|0|5|0 1|0|6|0 2|18|29|0 3|16|20|0 4|25|32|0 5|6|16|0 6|32|41|0 7|20|25|0 # Block |Sequence 0| file :/ data / npidb / pdb / pdb_new / models / 2k1n.MDL1.pdb :A:0:8:53 0| file :/ data / npidb / pdb / pdb_new / models / 2k1n.MDL1.pdb :D:0:8:53 0| file :/ data / npidb / pdb / pdb_new / models / 2k1n.MDL1.pdb :B:0:8:53 1| file :/ data / npidb / ...

Еще в разделе: (Показать все результаты (>6454) - monkey.belozersky.msu.ru/ )

• http://monkey.belozersky.msu.su/npidb/pdb/pdb_new/Block_3D/PF00320.22.fasta.hb
• SVETKA, a program for multiple sequence alignments analysus
• Molecular biology databases

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... It is necessary to note that a change-point detection method which we applied to a real EEG signal was developed on the basis of the piecewise stationarity model of the signal. ... The data presented in this Chapter demonstrate that the effective detection of the change-points opens the way for a number of new methods of the analysis of complex signals such as the EEG. ...

Еще в разделе: (Показать все результаты (>85) - brain.bio.msu.ru/ )

• Parametric segmentation of the EEG

Space Weather . ... Models . Data . ... Space Weather Analysis Centre of SINP MSU provides information about the current state of near-Earth's space. Information Services ( SWX ) on the website of the center provide access to current data describing the level of solar activity, geomagnetic and radiation state of the magnetosphere and the heliosphere in the real time. For data analysis, the models of the space environment, working in off-line as well as on-line mode have been implemented. ...

Еще в разделе: (Показать все результаты (>1339) - swx.sinp.msu.ru/ )

• SWX - Космическая погода
• Index of /models
• Index of /models/database/db/001108