... Accumulate Functions . ... MPI_ACCUMULATE(origin_addr, origin_count, origin_datatype, target_rank, target_disp, target_count, target_datatype, op, win) . IN origin_addr] initial address of buffer (choice) . ... Accumulate the contents of the origin buffer (as defined by origin_addr, origin_count and origin_datatype) to the buffer specified by arguments target_count and target_datatype, at offset target_disp, in the target window specified by target_rank and win, using the operation op. ...

Еще в разделе: (Показать все результаты (>479) - www.parallel.ru/ )

• Examples using MPI_SCATTER, MPI_SCATTERV | PARALLEL.RU -
• Library Example #2 | PARALLEL.RU - Информационно-аналитический центр по
• Attributes Example | PARALLEL.RU - Информационно-аналитический центр по

... Numeration assumed . Sequence conservation . ... All contacts alignment . ... According to the alignment derived from Pfam database with all fragments removed, there can be picked out several most conserved residues: . On the scheme above, amino acid residues of ETS domain sequence are highlighted according to their conservation level, while not conserved residues are shown as X, the subscript telling the possible number of such AA residues. ... S main page < Previous page Next page > ...

Еще в разделе: (Показать все результаты (>437) - monkey.belozersky.msu.ru/ )

• ETS numeration assumed
• SDP home page
• Example of supporting positions

... О UNИX . ... UserPreferences . ... You can predefine, disable or remove several options on the user preferences page using the following parameters in your wiki config: . ... Default . ... a list of checkbox names to be disabled in the user preferences. A disabled checkbox is displayed greyedout and uses the default value set in user_checkbox_defaults . ... a list of form defaults for user preferences. user_form_disable . a list of form field names to be disabled in the user preferences. ...

Еще в разделе: (Показать все результаты (>1333) - uneex.mithril.cs.msu.su/ )

• HelpOnUserHandling - UNИX
• HelpOnSpellCheck - UNИX
• HelpOnSpam - UNИX

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>7282) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example
• NPG-explorer

As of 1.3, the Apache source directories have been re-organised. This re-organisation is designed to simplify the directory structure, make it easier to add additional modules, and to give module authors a way of specifying compile time options or distribute binary modules. ... The non-module source files have moved from src into src/main . ... Configure . ... For example, say it is called mod_demo.c. The archive for this module should consist of two files, in a suitable directory name. ...

Еще в разделе: (Показать все результаты (>102) - neptun.sai.msu.ru/ )

• Apache module mod_headers
• Apache module mod_alias
• Upgrading to 1.3 from 1.2

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>26) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... METHOD . ... public interface AttributeSet . AttributeSet is an inquiry interface for a collection of Attributes. ... Tests if the Attribute identified by name is in this set. ... Retrieve the attribute associated with the specified name. ... Returns AttributeIterator for the elements. ... a new Array containing the elements of this set. public Attribute get (java.lang.String name) . ... If a different Attribute with the same name, was in the set, it is returned, otherwise null is returned. ...

Еще в разделе: (Показать все результаты (>232) - angel.cs.msu.su/ )

• : Class Schema
• DataTable
• SpectrumDataViewerGraph

Click here...

Еще в разделе: (Показать все результаты (>5) - hea-www.harvard.edu/ )

. Sites . Remove access privilege . You can remove yourself from the Owner, Collaborator, or Viewer list from this site by clicking the "Remove Access" button. Once access is removed it can not be undone by yourself. Remove access . Cancel

Еще в разделе: (Показать все результаты (>2) - cjs.iaas.msu.ru/ )

• Report Abuse

Mj lnir: Impact Crater . ... 10.06.1999 . ... For example, this false color image produced from seismic data shows a recently discovered ringed structure about 24 miles wide on the floor of the Barents Sea . It is most probably the result of the impact, roughly 150 million years ago, of a mile or so wide asteroid-like body. ... Drawing on Norse mythology , the crater has been aptly named Mj lnir - Thor's hammer. ... NASA Web Site Statements, Warnings, and Disclaimers . ...

Еще в разделе: (Показать все результаты (>7251) - www.astronet.ru/ )

• Beneath Venus' Clouds
• Beneath Venus Clouds
• Астронет > Beneath Venus' Clouds

Using stand-alone SDPfox . ... To add a new specificity group, type in the group name and press "Add" . To change composition of specificity groups, select two groups: first, from which to remove sequences, and second, to which to add sequences. ... For a constructed grouping, it is possible to run SDPgroup, re-randomize grouping or move sequences according to the best weights (see algorithm) under the link 'SDPgroup'. ... These sequences are likely to be re-grouped after SDPgroup is performed. ...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPsite - Algorithm Format requirements

... Next: Curves to section conversion Up: Data Analysis (Operations Menu) Previous: Data Analysis (Operations Menu) Contents Index . Figure 3.10: 3D Image. The program allows to build three dimensional images of the surface. ... To refresh the 3D image in this case click it with the left mouse button and hold it for a second, and release. ... To fulfill this press the Left Button of the Mouse and leaving it pressed move the Mouse in Left and Right directions. ...

Еще в разделе: (Показать все результаты (>65) - www.spm.genebee.msu.ru/ )

• Fast probe landing and retraction
• FemtoScan Online FAQs
• Moving the scanning window

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... account has been moved to a remote system! ... Re: account has been moved to a remote system! [ re: blum ] . ...

Еще в разделе: (Показать все результаты (>7375) - www.fds-net.ru/ )

• Skins [eng/ru] - Public forum of MSU united student networks
• Поздравляем дипломированного ксера Андрюху - Public forum of MSU united student
• [News] Научное программное обеспечение - Public forum of MSU united student

... Е. з. бДпДкъЦЗ м~ВћМњИ ^ВМЪ йћВЛМВММУ,,У ЛМТЪЛЪЫЪ flВ Мњi ЛТТОВУ,МЛИ, СЫћМ еУТНУ,ТНУИ УћО. ї бi еВ, Е.з., 1996 ( ), . ... бДпДкъЦЗ Е.з. зйЗДь ланмДсаь З дЗДзнйЗйв еЦпДзадЦ 81 ). .. , . ... V = const sin(kx) ( cos(kx), exp(ikx), exp(- ikx)), k = E - V . V. , , , = 0 = a ( , 82 лйкйлйЗлдав йЕкДбйЗДнЦгъзхв ЬмкзДг, <7, 1996 ). , , , ( ). sin(nx) c : n = 1, 2, 3, ... , = 1, 4, 9, ... (. . ... 4. (, ) ( ). 86 лйкйлйЗлдав йЕкДбйЗДнЦгъзхв ЬмкзДг, <7, 1996 зЦгазЦвзхЦ мкДЗзЦзаь , V(x) S(E ) , , , . ...

Еще в разделе: (Показать все результаты (>88) - nuclphys.sinp.msu.ru/ )

The revision of the MASS/DIMM star catalogue N. Shatsky, V. Kornilov March 16, 2008 Abstract The compilation of the (updated) version of the MASS (MASS/DIMM) device target catalogue is described. ... Then the list was cleaned according to following criteria: I. Remove stars too faint for a MASS device. ... Here the color equation of the Sternb erg device was taken: M AS S mag = V mag + 0.45 (B - V ); stars with M AS S mag > 3.2 were removed. ... This was made based on the GCVS4.2 catalogue data. ...

Еще в разделе: (Показать все результаты (>23) - curl.sai.msu.ru/ )

. Deprecated : mysql_connect(): The mysql extension is deprecated and will be removed in the future: use mysqli or PDO instead in /wcmc/lms/lms/includes/database.mysql.inc on line 31 . Warning : mysql_connect(): Can't assign requested address in /wcmc/lms/lms/includes/database.mysql.inc on line 31 . Can't assign requested address

38. download:rn-080423 [CompHEP]

39. A Universal Diagram for Gravimagnetic Rotators

40. TES. Modeling example.