This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>95) - neptun.sai.msu.ru/ )

• Stopping and Restarting Apache
• Apache module mod_vhost_alias
• Apache's Handler Use

. Участники . Исследования . Телеконференция . English Version | Сотрудники Центра | Партнерство . Оформление сайта . Сохраним природу . Учительская . Обучение . Олимпиада "Ломоносов" . Международное сотрудничество . Сайт поддерживается: . Институтом экологического почвоведения МГУ . Фондом исследования аграрного развития . webmaster@mail .

Еще в разделе: (Показать все результаты (>14) - www.ecocoop.ru/ )

• The Ecological Cooperation project is the first large scale childrenтАЩs
• Children's ecological telecommunication project

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: example, level Chinese luxury cosmetics b . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>2035) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: shall year June best example,
• Экологический Форум - Фундаментальная Экология: center China. the example, the
• Экологический Форум - Фундаментальная Экология: on the will example, refine

... News . ... 32-bit Microcontroller Programming . Microcontroller Control of Motors . Second-year students classes . ... Parallel Programming . ... Microcontroller Programming . ... Microcontroller-related . ... Serguey Elizarov . Serguey Zapunidi . ... Alexander Karabutov . ... Serguey Yakovlev . ... We sincerely wish you a Happy New Year and Merry Christmas! We hope that this year has been for you a year of new achievements. ... Happy New Year 2016! ... Hits . ... Written by Pavel . ...

Еще в разделе: (Показать все результаты (>66) - engineering.phys.msu.ru/ )

• Science Festival 2013

... As of this time, only HTML output is supported by this template. ... The reason you need to know this is that the Examples Section only supports HTML output because the examples without images would be pretty useless. ... You'll note that all the code in the template after this line is tagged to be used only by HTML. ... Anyway, this is just to show how you could do an example. Here is an example of how the sparkle plug-in can be used to add both lens flare and a feathered edge to an image. ...

Еще в разделе: (Показать все результаты (>1086) - www.sai.msu.su/ )

• FTS Parser Example
• The Sparkle Plug-In: Example Images
• GIMP Plug-In Examples

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>4) - storage.bioinf.fbb.msu.ru/ )

... I believe in the sun and the sky Words that just don't seem to tell me why @ SONG : Rope Around My Neck [questionable -- unintelligibly miked] Try to point her to a sign ('Cos I) Never tell what's on my mind Except I love you And you took what I'm calling you Only your funeral Hang a rope around my neck And no wonder[?]longer I turn dead I love you @ SONG : Bordeaux [live at Womad 88] In France you are sleeping I wish I could see you It's always this way Love ...

Еще в разделе: (Показать все результаты (>2293) - crydee.sai.msu.ru/ )

• A Simple Example With a Single Chirp Component
• One example
• Long description for example showing how structurally overlapping cells are

IN THE BRANCH OF HISTORICAL-PHILOLOGICAL SCIENCES OF THE RUSSIAN ACADEMY OF SCIENCES . ... About Lessons and Experience of the Great Patriotic War . ... Documents of Archives of the FSB of Russia . ... Actual problems of Historical Knowledge . ... Keywords: the Branch of Historical-Philological Sciences of the Russian Academy of Sciences; report . ... The author analyzes lessons of the Great Patriotic War and post-war conflicts from the point of view of use of its historical experience. ...

Еще в разделе: (Показать все результаты (>61) - hist.msu.ru/ )

• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>50) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>737) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples

To get an overview of section 1 (one) of the manual: man 1 intro . ... This displays a one line synopsis of each command that has this keyword in its description. To search the online manual for a command with the phrase "copy files": man -k 'copy files' . ... To check what a command does: whatis more more, page (1) - browse or page through a text file . ... To display the manual page for the cp (copy files) command: man cp . ... To print the manual page for the man command: man -t man . ...

Еще в разделе: (Показать все результаты (>473) - comet.sai.msu.ru/ )

• Examples of creating files
• Example of changing a password with the passwd command
• Examples of changing environment variables: Bourne shell

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>18) - mouse.belozersky.msu.ru/ )

• Alignment example
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

. [ Войти ] . Главная -> Фильмы -> Love on a Branch Line . Пользователи . Демо . Деньги . Фильмы . Форум . Love on a Branch Line . Великобритания 1994 . отметить . Сериал . Комедия .

Еще в разделе: (Показать все результаты (>266) - kinfo.ru/ )

• Children of Dune - Фильмы - Kinfo.ru
• Judge Hardy's Children - Фильмы - Kinfo.ru
• Fantastic Children - Фильмы - Kinfo.ru

... As an example of such graphic software environments it is possible to name software «Alice» (http://www.alice.org/), which created by «Stage3 Research Group» (Carnegie Mellon University) and allows designing the virtual 3-D worlds, interactive games, animated stories without special programmer abilities. ... In «Alice» it is possible to create various 3Dprojecs, with ready or imported, for example from «3D Studio», models, using animation, sound-effects and object's transformation. ...

Еще в разделе: (Показать все результаты (>92) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc151681/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc151660/eng.pdf

... These are signatures of a chain reaction mechanism) 5.60 Spring 2008 Lecture #33 page 2 Proposed mechanism for this reaction: k Initiation: CH3CHO 1 CH3 · + CHO · k Propagation: CH3 · + CH3CHO ·CH3CO k k 3 2 ·CH3CO + CH4 CH3 · + CO Termination: 2 CH3 · 4 C2H 6 Side Reactions : CHO · + M k 5 CO + H· + M k 6 H· +CH3CHO H2 + ·CH3CO Kinetic Equations: d[CH4 dt ] = k2 [ CH3 ·][ CH3 CHO ] d[ EXPLOSION!! ... Branching chain reactions also occur in nuclear reactions, for example. ...

Еще в разделе: (Показать все результаты (>175) - chem.msu.ru/ )

• Client-side Clickable Image Example
• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round

... The study is focused on forest ecosystems exposed to extreme air pollution from the nickel-processing industry in Northern Fennoscandia. Long-term deposition of heavy metals and sulphur has caused strong soil contamination and severe damage to trees and ground vegetation, their structure, composition and chemistry. ... Multivariate analyses show that changes in the element composition of plants depend both on air pollution and on natural factors. ...

Еще в разделе: (Показать все результаты (>28) - eco.soil.msu.ru/ )

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

... О UNИX . ... Examples . ... 1 s = raw_input () 2 repeat = 0 3 for i in xrange ( 1 , len ( s )+ 1 ): 4 found = 1 5 for k in xrange ( 1 , len ( s )/ i ): 6 equal = 0 7 for j in xrange ( i ): 8 if s [ j ]== s [ j + i * k ]: 9 equal += 1 10 if equal == i : 11 found += 1 12 if found * i == len ( s ): 13 if repeat < found : 14 repeat = found 15 print repeat . ... LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples (последним исправлял пользователь PavelSutyrin 2014-11-05 12:16:59) . ...

Еще в разделе: (Показать все результаты (>159) - uneex.mithril.cs.msu.su/ )

• HelpOnSlideShows - UNИX
• Index of /static/GimpDoc_EnRu/images/dialogs/examples
• HelpOnMoinCommand/ExportDump - UNИX

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt