... Examples . ... The window at each process consists of array A , which contains the origin and target buffers of the put calls... while(!converged(A)){ update(A); MPI_Win_fence(MPI_MODE_NOPRECEDE, win); for(i=0; i < toneighbors; i++) MPI_Put(&frombuf[i], 1, fromtype[i], toneighbor[i], todisp[i], 1, totype[i], win); MPI_Win_fence((MPI_MODE_NOSTORE | ... Example Same generic example, with more computation/communication overlap. ... Центры . ...

Еще в разделе: (Показать все результаты (>694) - www.parallel.ru/ )

• Writing wrapper definitions | PARALLEL.RU - Информационно-аналитический центр
• Starting Multiple Executables and Establishing Communication | PARALLEL.RU -
• Options for
  <tt> mpirun
  </tt> | PARALLEL.RU - Информационно-аналитический

Электронная библиотека Попечительского совета . ... Shamms Mortier - 3ds max 5 for Dummies . ... Название: 3ds max 5 for Dummies . Автор: Shamms Mortier . ... With this easy-to-follow guide, you will learn how to use 3ds max to build 3D animations and special effects. ... 3ds max see also 'GUI' . 3ds max handshaking applications for 371-374 . 3ds max plug-ins for 365-373 . ... 3ds max starting 10 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>16835) - lib.mexmat.ru/ )

• KroahHartman G. - Linux Kernel in a Nutshell :: Электронная библиотека
• CustomGuide Inc - Access 2003 Personal Trainer :: Электронная библиотека
• Lane S., Love S., Bowers B. - Using FileMaker 8 :: Электронная библиотека

Morphology of shoot Leaf Introduction to Botany. Lecture 9 Alexey Shipunov Minot State University September 17th, 2010 Shipunov BIOL 154.9 Morphology of shoot Leaf Outline 1 Morphology of shoot Phyllotaxis Life forms Modifications of shoot Leaf Leaf mor phology 2 Shipunov BIOL 154.9 Morphology of shoot Leaf Outline 1 Morphology of shoot Phyllotaxis Life forms ... Leaf base (scheath etc.) ... Shipunov BIOL 154.9 ...

Еще в разделе: (Показать все результаты (>488) - herba.msu.ru/ )

... x264 is an open source codec of standard MPEG4 AVC/H.264, developed by programmers from all over the world. ... Accumulated during previous frames' compressions statistic is actively used by codec to improve effectiveness of adaptive models. ... These parameters are used only before encoding start, so, our improvements are more significant for short sequences. ... 3 Results of codec x264 modification on "flower" sequence . ... 5 Results of codec x264 modification on "flower" sequence, low bitrates ....

Еще в разделе: (Показать все результаты (>263) - graphics.cs.msu.ru/ )

• x264 codec improvement | Лаборатория компьютерной графики и мультимедиа
• GML MatLab Camera Calibration Toolbox | Graphics and Media Lab
• GML MatLab Camera Calibration Toolbox | Лаборатория компьютерной графики и

All Firefly versions can take optional command line arguments. ... firefly [optional command line options in any order] [optional list of working directories] . ... The list of most widely used command line options is given below: . ... Disables validity check of the command line arguments (e.g., check for valid names of files and directories, etc...) passed to Firefly. ... However, if this option is not given, one must provide the list of working directories when running Firefly in parallel mode. ...

Еще в разделе: (Показать все результаты (>104) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - running in parallel using LAM/MPI
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using WMPI
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using

Nominal modification at the Syntax-Semantics Interface: comparing attributive adjectives in Italian and English In his seminal work, Bolinger (1967) discusses an asymmetry between two functions that adjectives can perform, namely attributive and predicative modification; furthermore, he points out that the syntactic asymmetry between the pre- and the post-nominal position of a number of adjectives in English is related to a semantic difference between reference- and referentmodification, respectively. ...

Еще в разделе: (Показать все результаты (>364) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.doc
• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/trugman.pdf

... Parsimony method . ... It is based on the following principle: the ancestral sequences (posed in nodes of a phylogenetic tree) should be such that the minimal required number of character replacements on the branches of the tree is less than for any other choice of sequences. ... If the preliminary character of the node is * , but the output character of its immediate ancestor is some letter (say, X ), and its set of possible characters contains X , then the output character of the node is also X . ...

Еще в разделе: (Показать все результаты (>552) - monkey.belozersky.msu.ru/ )

• SDPpred
• SCOP famyli: beta-Glucosyltransferase (DNA-modifying)
• SDP home page

Synthesis of Alkoxysilylated Humic Derivatives with Different Modification Rate Capable of Self-Adhering to Mineral Surfaces Leonid A. Karpiouk1, Irina V. Perminova1, Sergey A. Ponomarenko2, Aziz M. Muzafarov2, Kirk Hatfield 1 3 Department of Chemistry, Lomonosov Moscow State University, 119992, Moscow, Russia, Institute of Synthetic Polymer Materials, Profsoyuznaya str., ... It is aimed at modification of carboxyl groups available within HS with 3-amino-propyltrimethoxy-silane (APTS). ...

Еще в разделе: (Показать все результаты (>163) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2010/2010-kholodov-detoxifying.pdf
• http://www.mgumus.chem.msu.ru/publication/2008/2008-shcherbina-interaction.pdf
• http://www.mgumus.chem.msu.ru/publication/2005/kholodov-enchanced-2005.pdf

... file but would like it to be automatically updated # again, run the following command: # sudo dpkg-reconfigure -phigh xserver-xorg Section Files EndSection Section InputDevice Identifier Generic Keyboard Driver kbd Option CoreKeyboard Option XkbRules xorg Option XkbModel pc105 Option XkbLayout us ...

Еще в разделе: (Показать все результаты (>35) - observ.pereplet.ru/ )

• MASTER GLOBAL ROBOTIC TELESCOPES NET

... License . ... This program is free software: you can redistribute it and/or modify . it under the terms of the GNU General Public License as published by . the Free Software Foundation, either version 3 of the License, or . ... This program is distributed in the hope that it will be useful, . ... GNU General Public License GNU General Public License for more details. ...

Еще в разделе: (Показать все результаты (>24) - mouse.genebee.msu.ru/ )

• ConClus

Previous article . ... Abstract Stability of native and modified glucose oxidase from Aspergillus Niger (GOD) and formate dehydrogenase from the methylotropic bacteria Pseudomonas sp. 101 (FDH) were studied in water systems. ... But in case of FDH its stability hydrophobil-lipofilic balance – sensitive. ... Moscow University Chemistry Bulletin . 2003, Vol. ... Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>972) - chem.msu.ru/ )

• Benzene alkylation with alkanes over modified MFI catalysts
• Modified silica as a stationary phases for ion chromatography
• Moscow University Chemistry Bulletin Vol. 51, No. 6, P. 440 (2010)

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>90) - comphep.sinp.msu.ru/ )

• install [CompHEP]
• download:rn-080423 [CompHEP]
• download:rn-070702 [CompHEP]

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>252) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services Help
• GeneBee BLAST 2.2.22+ Services Help
• AliGraf - GeneBee Graphical Alignment Help

... The image view depend much upon proper correspondence between color and height -- palette. ... If the palette is absent at the Tool Bar, it can be called by putting a tick in the Menu View/ Tool bars against Scale . The choice of current palette is done by Mouse click on the palette image using Right Button - the Menu with all palettes listed appears. ... This behavior can be changed for an image, if user put a tick against the menu item View/ Remember Palette . ...

Еще в разделе: (Показать все результаты (>183) - www.spm.genebee.msu.ru/ )

• Hysteresys calibration file generation
• ATOMIC FORCE MICROSCOPY STUDY OF BACTERIAL CELLS
• Scanners

... Karlsruhe Institute of Technology (KIT) . 76021 Karlsruhe/Germany . ... Most technological applications of crystalline materials are based on the modification of their microstructure (e.g. of their grain size and/or of the topology of different phases that may be present). ... Glasses with this microstructure will be called poly-glasses in analogy to poly-crystals). ... Professor , Institute of Materials Science, University . ... Founding Director and Senior Member of the Institute of New . ...

Еще в разделе: (Показать все результаты (>158) - www.chem.msu.ru/ )

... All circuit parameters have been presented in a symbolic form. ... To use the program you will need a CIR file (PSpise, DesignLab file) of your circuit. CIR file examples have been enclosured: bpasside.cir, test1.cir, test2.cir, test3.cir, test4.cir, laksamp.cir, bridge.cir, uA741acf.cir, quartz.cir. ... Ideal operational amplifier (nullor) * Nname n1 n2 n3 n4 * * In the ideal op amp data, (n1,n2) represent output nodes, * (n3,n4) represent input nodes (noninverting, inverting). ...

Еще в разделе: (Показать все результаты (>21) - astrometric.sai.msu.ru/ )

• Symbolic matrix processor

... A modification of the CABARET scheme for the computation of multicomponent gaseous flows" . Danilin A.V. and Solovjev A.V. An explicit numerical algorithm for computing one-dimensional motion of multicomponent gaseous mixtures is proposed. ... Keywords: one-velocity multicomponent medium, systems of hyperbolic equations, CABARET scheme, computational fluid dynamics (CFD), finite volume methods. PDF (Full text in Russian, References in English) (235KB) . ...

Еще в разделе: (Показать все результаты (>292) - num-meth.srcc.msu.ru/ )

• A modified generalized residual method for minimization problems with errors of
• "Modified two-step Levenberg-Marquardt methods in the hydraulic conductivity
• A stochastic modification of the spherical block-and-fault model of lithosphere

... Re: may someone tell me how to write the following sentences in russia [ re: CAnEP ] . ... Re: may someone tell me how to write the following sentences in russia [ re: nu3geTC ] . ... Re: may someone tell me how to write the following sentences in russia [ re: DizzyDen ] . ... Re: may someone tell me how to write the following sentences in russia [ re: Spring ] . ...

Еще в разделе: (Показать все результаты (>10477) - www.fds-net.ru/ )

• как настроить smb.conf и запустить демоны smbd и nmbd? - Public forum of MSU
• Программисты шутят - Public forum of MSU united student networks

Fortran DVM Compiler . User's guide . ... 6 Compiling HPF-DVM program . ... The extension is implemented as special comments (directives) that annotate sequential program in Fortran 77. ... If the source program has INCLUDE statements and not all include-files are in the current directory, it is necessary to use the option . ... User's guide" and "Debugging DVM-program performance. ... A syntax error was found while parsing the Fortran statement or DVM directive. ... Missing DVM directive prefix . ...

Еще в разделе: (Показать все результаты (>201) - sp.cs.msu.ru/ )

• Debugging DVM-program. User's guide. Part 1
• Prefictor of DVM-program performance. User's guide
• C-DVM compiler. User's guide

... Method Detail protected final void init ( ConcreteIndexMap.ZZMap iMap, ConcreteIndexMap.ZZMap lengthsMap) . ... iMap - ZZMap defining the forward transform. protected final void link ( ConcreteIndexMap prev, ConcreteIndexMap.ZZMap iMap, ConcreteIndexMap.ZZMap lengthsMap) . ... prev - ConcreteIndexMap this is composed with. iMap - ZZMap defining the forward transform. lengthsMap - ZZMap defining the reverse transform. protected final void link ( ConcreteIndexMap prev, ConcreteIndexMap.ZZMap iMap) . ...

Еще в разделе: (Показать все результаты (>91) - angel.cs.msu.su/ )

• Appendix B File Format Specification
• Appendix A Units
• : Package ucar.multiarray