PHYSICAL CONSTANTS OF SOME ELEMENTS ________________ CRC Handbook of Chemistry and Physics, 84th Edition, 2003-2004. 4

Еще в разделе: (Показать все результаты (>49) - electr003.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/rus/spec/Vvedenie_v_spetsialnost_2/Measurements_of_pH.pdf
• http://www.elch.chem.msu.ru/rus/7_8_2009_supplement.pdf
• Alexander M. Kuznetsov

... Abstract A. V. Dmitriev, A. V. Ivanov, A. R. Khokhlov, Numerical simulation of light propagation through a diffuser, Fundamentalnaya i prikladnaya matematika, vol. 15 (2009), no. 6, pp. ... In this article, the light propagation in a diffuser with optically soft inclusions is described with the help of the Fokker--Planck equation, i.e., a transfer equation with a diffusion term in the space of radiation propagation directions. ... 8, 9] , x1 , : 1 D = (3 - x1 ), 6 3 x1 = 2 d x( )cos sin . ...

Еще в разделе: (Показать все результаты (>16) - lizard.phys.msu.su/ )

pic] [pic] PARTNERSHIP AGREEMENT between the Russian Rectors' Union and the Russia Machine Builders' Union The Russian Rectors' Union (RRU) and the Russian Machine Builders' Union (RMBU), hereinafter referred to as The Parties Confirming the importance of the further development and strengthening of partnership relations between the scientific-educational ...

Еще в разделе: (Показать все результаты (>22) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/242.doc
• http://www.rsr-online.ru/doc/norm/525.doc
• http://www.rsr-online.ru/doc/norm/173.doc

... S = k·log I . ... S S , 1698-1758 . k , 1795-1878 . S S1, - S/S=const. : - const. ... S/S ~ const - S 2- : ? ... 0,25 =0,75 Sj ­ , Si ­ P(S1,S2) = 0,7 S1 S2 S3 S1 S2 S3 P(S2,S3) = 0,8 * 7 6 3 * 8 4 2 * P(S1,S2) = 0,6 S1 S1 S2 7 * S2 3 * S3 4 2 S1 S2 S1 * 0,7 S2 * S3 0,2 0,3 0,4 S3 6 8 * S3 0,6 0,8 S1 S2 * 0,09 * S3 -,090 * Sj - Si = 1,44 * z S1 j,i * 0,52 0,25 -0,52 -,025 S2 S3 . ... 1-15%: , . ...

Еще в разделе: (Показать все результаты (>2) - www.soc-phys.chem.msu.ru/ )

... Nonlinear optics of ionized mediums . Fiber lasers . ... Emergence of powerful laser systems, being able to deliver powerful ultrashort light pulses, allows one to investigate and exploit new class of nonlinear-optical phenomena, based on the media ionization, when the electrons are released by strong electromagnetic field directly or by collision of an atom with another electron accelerated in the field. ... Ultrafast optical switching of an ionized medium by interfering ultrashort laser pulses. ...

Еще в разделе: (Показать все результаты (>3) - photonicslab.phys.msu.ru/ )

... All Authors Title Abstract Index terms Full Text . ... Home > ICONO/LAT 2016 > 2014 International Conference on Laser Applications in Life Sciences > About the Conference > Submissions . ... All URL addresses in the text (e.g., http://pkp.sfu.ca ) are activated and ready to click. ... If submitting to a peer-reviewed track of the conference, authors' names are removed from submission, with "Author" and year used in the bibliography and footnotes, instead of authors' name, paper title, etc. ...

Еще в разделе: (Показать все результаты (>17) - hea.phys.msu.su/ )

• Search

... Ed. by Utyuzhnikov S.V., Tirskiy G.A. Authors: Tirskiy G.A., Sakharov V.I., Kovalev V.L., Brykina I.G. et al. ... Journal of Applied Mathematics and Mechanics. Vol. 25, no. ... I.G. Brykina, V.V. Rusakov, and V.G. Shcherbak. ... Journal of Applied Mechanics and Technical Physics, Vol. 32, no. ... I.G. Brykina, B.V. Rogov, and G.A. Tirskiy. ... I.G. Brykina, B.V. Rogov, G.A. Tirskiy, V.A. Titarev, and S.V. Ultyuzhnikov. ... I.G. Brykina, B.V. Rogov, G.A. Tirskiy, V.A. Titarev, and S.V. Utyuzhnikov. ...

Еще в разделе: (Показать все результаты (>6) - lab106.imec.msu.ru/ )

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>45) - sn.sai.msu.ru/ )

... Probe flash (energy/duration) . ... 0.01 J / 0.01 ms . ... Submersible unit (dimension/weight) . Power supply unit (dimensions/weight) . ... 300 x 300 x 50 mm / 1 kg . ... Power supply . ... The complete set of PrimProd fluorometer consists of the following mainframes: submersible probe, 12 DC on-board block power supply, IBM-compatible computer, connecting cables and cable-rope. ... Submersible probe. ... On-board power block provides the necessary voltage (42 V) supply at the submersible probe. ...

Еще в разделе: (Показать все результаты (>4) - www.biophys.msu.ru/ )

• Как отмечалось выше, обилие (по Fo) и фотосинтетическая активность

... For the investigations of the phenomenon leading to non inflation (squidding) of parachute, the influence of canopy permeability and upstream flow on the character of pressure distribution along framework model, imitating round parachute, was studied experimentally. ... The pressure sensors: 13 ones inside and 13 - outside the canopy have been placed for the study of distribution of internal and external pressure on the surface of the model. ... Variant 1. ... Parachute Science] . ...

Еще в разделе: (Показать все результаты (>6) - margaret.imec.msu.ru/ )

• On Square Parachute Differential Equations

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf

... Siberian Lang . Minority languages of Siberia as our cultural heritage . ... The project ?Development of the web-site ?Minority languages of Siberia as our cultural heritage? (on the material of the languages of the basin Middle Yenisei and the Middle and the Upper Taz)? was realized at the Laboratory for Computational Lexicography, Research Computing Centre, Lomonosov Moscow State University, with financial support from Russian Foundation for the Humanities, grant 12-04-12049.љ ...

213. "Lasers and nonlinear optics" practical course laboratory

214. ЛАБОРАТОРИЯ АВТОМАТИЗИРОВАННЫХ

215. Библиотечная Компьютерная Сеть | FAQ | создание электронного каталога

216. http://www.test.physchem.msu.ru/doc/instr-110319.doc

217. http://www.antropos.msu.ru/zzx/11_2_en.doc

218. http://danp.sinp.msu.ru/LIIWM/JPhysb40_2007_329.pdf

219. http://zmmu.msu.ru/morphology/library/Dzer_Korzoun_2004.pdf

220. http://temporology.bio.msu.ru/EREPORTS/krugly_the-dinamics.pdf