... Затем необходимо скопировать файл \texmf\web2c\updmap.cfg в папку \localtexmf\miktex\config\, и в конец файла дописать 2 строчки: # pscyr Map pscyr.map После этого необходимо обновить файловую базу MikTeX (Start->Programs->MikTeX->MikTeX Options, Refresh Now) и дополнительно запустить (через командную строку) программу: \texmf\miktex\bin\mkfntmap.exe MikTeX 2.5 ========== Архив pscyr04c_miktex.zip необходимо распаковать в папку \MikTeX 2.5. ...

Еще в разделе: (Показать все результаты (>3) - oc.cs.msu.su/ )

Dynamo Theory and Earth's Magnetic Field Paul Demorest May 21, 2001 1 Intro duction The Earth's magnetic field belongs in that class of physical phenomena which are commonplace yet also very complex. ... 3 Single Disc Dynamo Before we dive into the mess of equations and approximations that describe how fluid motion and magnetic field interact, it is useful to demonstrate a very simple system which exhibits dynamo action. ... A system without fluid motion cannot support a magnetic field indefinitely. ...

Еще в разделе: (Показать все результаты (>11) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/geo/lectures-addons/02/2009%20Bromm%20et%20al.%2C%20The%20formation%20of%20the%20first%20stars%20and%20galaxies.pdf

... Electronic journal Issue 4. 10 september 2004 Ulrich M. Sustainable Management of Natural Resources Introduction. ... To learn about the dynamics of natural resource management and the tragedy of the commons by means of a direct experience in the simulation game ?NEW COMMONS GAME?. ... 2) Tragedy of the commons and management of natural resources. ... The simulation game was followed by a short debriefing on the dynamics of the tragedy of the commons and natural resource management. ...

Еще в разделе: (Показать все результаты (>9) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./vorontchuk.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf

... THE TIME HAS COME FOR "THUNDER BOOKS" . ... You may have forgotten what a thunder book is, or maybe you didn't ever use that name. ... It is a handy reference to those things you need to know about soils and how they behave. ... Well, if you knew how to use them as pages in a thunder book it would surely be a good start, but you need something uniquely yours. ... It has always been my belief that the mission of a soil survey is to help people understand and wisely use soil resources. ... Good read. ...

Еще в разделе: (Показать все результаты (>3) - www.paleopedology.msu.ru/ )

... We develop a post-processing algorithm which enhances the results of the existing image deblurring methods. It performs additional edge sharpening using grid warping. ... The best results are achieved when grid warping is used as a post-processing method after global image deblurring methods. ... Method . ... PDF . ... Image warping as an image enhancement post-processing tool // In: Proceedings of 9th Open German-Russian Workshop on Pattern Recognition and Image Understanding (OGRW 2014) . ...

Еще в разделе: (Показать все результаты (>132) - imaging.cmc.msu.ru/ )

• View publication | Laboratory of Mathematical Methods of Image Processing

... The Faculty of Materials Science General Information . ... Students complete a number of special theoretical and practical training courses with the best MSU professors to have advanced training in mathematics, chemistry, physics and mechanics. ... Such a small student admission is a deliberate choice intended on individual training program for each student. The main advance in education is extensive emphasis on research and creativity that facilitates scientific results of the students. ...

Еще в разделе: (Показать все результаты (>3) - www.fnm.msu.ru/ )

... 209 ґ 212 209 THE ROLE OF THE NATIVE POND ODOR IN ORIENTATION OF THE GREEN TOAD (Bufo viridis LAUR.) YOUNGS-OF-THE-YEAR V. V. Shakhparonov1 and S. V. Ogurtsov 1 Keywords: toadlets, orientation, native pond odor, buffer zone, periods of learning. ... Individuals from the "buffer" zone prefer the native pond water during a week before the beginning of dispersal (as described by a distribution stability coefficient S; Fig. ... The latter are, probably, individuals ready for dispersal. ...

Еще в разделе: (Показать все результаты (>35) - vertebrata.bio.msu.ru/ )

• Background of the Department
• Выступления студентов и аспирантов на конференциях
• Student Reports at International Conferences

THE FOURTH ANNUAL SCIENTIFIC STUDENT CONFERENCE "TOPICAL HUMANITARIAN ISSUES OF OUR TIME" ABSTRACTS PANEL OF POLITICAL SCIENCE THE NATO STRATEGIC CONCEPT Balandina Anastasia The Faculty of political science 3rd year student The North Atlantic Treaty Organization, instituted in 1949, is going through tough times. ... THANK YOU FOR NOT SMOKING Margusheva Alina The Faculty of political science 2nd year student The work deals with the problem of smoking and its influence on health. ...

Еще в разделе: (Показать все результаты (>68) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/research/vestnik/4-2011-Ilson.pdf
• http://www.ffl.msu.ru/students/courses/fl-teaching/36-marinina-mir-izuchaemogo-yazyka-literatura.pdf
• About Us

See also the Proceedings of the 5th Russian-Japanese Symposium published in two volumes of FERROELECTRICS . ... Monday, August 22, 12:00-13:30 . ... Domain walls in crystals with incommensurate phase . ... Fluxes in incommensurate crystals . ... Ab initio calculations of electronic polarizability, lattice dynamics and phase instability in ionic crystals . ... Phase transitions in the vicinity of Lifshitz point in ferroelectrics-semiconductors . ... Isomorphous phase transitions in ferroelectrics . ...

Еще в разделе: (Показать все результаты (>39) - scon155.phys.msu.su/ )

• Direct determination of the shape of potential well for off-center Ge atom in

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

The principles of the double-flash fluorometry . ... During a weak probe flash (measuring light) chlorophyll fluorescence is measured with photosynthetic reaction centers of phytoplankton in the open (active) state; the fluorescence intensity reflects phytoplankton concentration in water samples.The actinic flash induces transition of reaction centers into the closed (inactive) state. ... During the second probe flash, chlorophyll fluorescence from closed reaction centers ( Fm ) is measured. ...

Еще в разделе: (Показать все результаты (>8) - www.biophys.msu.ru/ )

• (Chlorophyll Fluorescence in vivo: A Theory

... On-line консультант . ... Приглашаем всех, интересующихся исследованиями и разработками в области компьютерных сетей, принять участие в семинаре по software-defined networking, который состоится 4 июля 2011 (понедельник) в 19.30 в Политехническом музее (Новая площадь, д 34;, подъезд 9, малая аудитория). ... We are about to witness a revolution in the networking towards so-called "Software Defined Networking" (SDN). SDN enables innovation in all kinds of networks . ... Copyright ВМиК МГУ , 2008 . ...

Еще в разделе: (Показать все результаты (>2) - erp.cmc.msu.ru/ )

Application of the V--Ray Technology for Optimization of the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D Supercomputers Alexander S. Antonov, Vladimir V. Voevodin Moscow State University, Russia eґmail: voevodin@vvv.srcc.msu.su Abstract The paper shows an application of the soґcalled Vґ Ray Technology for optimizing the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D supercomputers. ... Results for CRAY YґMP supercomputers. al structure of the program. ...

Еще в разделе: (Показать все результаты (>11) - asa.guru.ru/ )

• Буриме от 4 сентября 1997 года
• Буриме от 5 сентября 1997 года
• Буриме от 11 сентября 1997 года

Welcome to ASC14 To whom it may concern With the supports from the High Performance Computing (HPC) experts and organizations, the ASC13 Student Supercomputer Challenge has concluded with great success. ... We are calling for registration and preliminary contest preparation. ... Some of them may finally take HPC as a career option, such as some students from National Defense University team have already contributed to the Tianhe-1A and Tianhe2. ... Award Overall Gold Winner: 100K RMB (~16000 USD) . ...

215. запись фильма

216. INTAS 95-525 Project

217. Integrated photonics | Laboratory of Nanophotonics & Metamaterials

218. http://ndsipu.cmc.msu.ru/student.php?id=2

219. Publications Keywords Search

220. proj_now