... 209 ґ 212 209 THE ROLE OF THE NATIVE POND ODOR IN ORIENTATION OF THE GREEN TOAD (Bufo viridis LAUR.) YOUNGS-OF-THE-YEAR V. V. Shakhparonov1 and S. V. Ogurtsov 1 Keywords: toadlets, orientation, native pond odor, buffer zone, periods of learning. ... Individuals from the "buffer" zone prefer the native pond water during a week before the beginning of dispersal (as described by a distribution stability coefficient S; Fig. ... The latter are, probably, individuals ready for dispersal. ...

Еще в разделе: (Показать все результаты (>43) - vertebrata.bio.msu.ru/ )

• Background of the Department
• Выступления студентов и аспирантов на конференциях
• Student Reports at International Conferences

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>23) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... A p P EC Astropar ticle Physics for Europe Ї Cosmic rays: A large array for the detection of charged cosmic rays ( Auger North) Ї Gamma rays: A large array of Cherenkov Telescopes for detection of cosmic high energy gamma-rays ( CTA ) Ї High energy neutrinos: A cubic kilometre-scale neutrino telescope in the Mediterranean (KM3NeT) Ї Dark matter search: Ton-scale detectors ... A p P EC Astropar ticle Physics for Europe Ї Cosmic rays: ґ ґ ґ ґ ґ AMS detector launched. ...

Еще в разделе: (Показать все результаты (>5) - tunka.sinp.msu.ru/ )

• http://tunka.sinp.msu.ru/en/presentation/Khrenov.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Field stations . ... Educational council . Science . ... International commission on continental erosion . ... Field training . ... Type of field courses . ... Interuniversity council for erosion and fluvial.. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Interdisciplinary seminars
• Department of Land Hydrology
• Department of Meteorology and Climatology

International Laser Center of MSU . ... News . ... Все новости . ... 3-d International Laser Graduate School "Modern Problems of Laser Physics LGS-2009 " . ... Home News Наука . ... International Conference on Photo-Excited Processes and Applications. ... Другие новости категории: . ... 2015 5 Международная конференция по фотонике и информационной оптике . 4-6 февраля 2016 г. НИЯУ МИФИ, Москва Заявку желательно подать до 1 ноября 2015г. на сайте конференции. ... Категория: Конференции . ...

Еще в разделе: (Показать все результаты (>160) - ilc.phys.msu.ru/ )

• Laboratory of Nonlinear Spectroscopy of Ultrafast Processes in Condensed Matter
• Laboratory of ultrafast processes in biology
• ILC of Bratislava

Unix 2006 519.6 , . ... Unix. ... Unix, , , ; , Unix, Gnu ( gcc, gdb Gnu Make), . ... Unix' ; , , , , Windows, MacOS .. ... Ctrl-]. , , make (.ї4.3), vim , gcc. make vim. , make prog, vim :make prog. , , " " . ... grep , , find (. ... name "*.c" -exec grep include {} #include <fcntl.h> #include <sys/stat.h> ./hel.c #include "stdio.h" ./kr.c .. grep ( !) -print . ... name "*.cpp" -o -name "*.c" \) -exec grep main {} \; -print int main() ./kr.c int main() ./hel.c int main() ./kr.cpp , find, , , , Unix. ...

Еще в разделе: (Показать все результаты (>4) - al.cmc.msu.ru/ )

• http://al.cs.msu.ru/books/avst/unix.ps
• http://al.cs.msu.ru/files/launch_asm.pdf

... C. Gibbons, M. Locke: Cupid and Death - Fourth Entry . К. Гиббонс, М. Локк: Купидон и Смерть - Явление четвертое . ... The scene is changed into a pleasant Garden, a fountain in the midst of it; walks and arbours delightfully expressed; in divers places, Ladies lamenting over their Lovers slain by Cupid , who is discovered flying in the air. ... Enter a Lover , playing upon a lute, courting his Mistress; they dance. ... Enter Cupid . ... If it be death to love, what will it be . ... Enter Death .) ...

Еще в разделе: (Показать все результаты (>22) - music.genebee.msu.ru/ )

• C. Gibbons, M. Locke: Cupid and Death - Entry 3

... Password request . Send me checkword . Login . ... E-mail . ... If you cannot remember your password, enter your login or e-mail you have used for registration. A message containing the check word you can use to change the password will be sent to your e-mail. ... Please log in. ... Password . ... Forgot password? Change password . Please enter the checkword and your new password . ... Checkword . New password Confirm password . Recover password . ... One-time password . ...

Еще в разделе: (Показать все результаты (>3) - www.ffl.msu.ru/ )

• Authorization - Факультет иностранных языков
• Change Password - Факультет иностранных языков

... ADSP2181 Data Sheet. ... ********************* ********* * * This sample program is organized into the following sections: * * Assemble time constants * Interrupt vector table * ADSP 2181 intialization * ADSP 1847 Codec intialization * Interrupt service routines ********************************************************* ********* .module/RAM/ABS=0 loopback; {************* ... transmit i? 68 |||! |||! |||+============= control bit ||+-------------|+--------------control bit +---------------- ! ...

191. Moscow Astronomical Plate Archives: Contents, Digitization, Current and

192. Wave function of helium-like ions

193. Directory listing of /E|/ftproot/literat/speleo/Copy of 35_let/foto

194. Master In Ecology ? Биологический факультет МГУ

195. http://al.cs.msu.su/static/seminars/catfl/reports/001_free_software/page2.html

196. Буриме от 4 сентября 1997 года

197. запись фильма

198. INTAS 95-525 Project

199. http://cryst.geol.msu.ru/en/

200. http://www.ffl.msu.ru/students/courses/fl-teaching/36-marinina-mir-izuchaemogo-yazyka-literatura.pdf