RC-, RL- RLC- 2001 RC-, RL- RLC-- . ... RLC-. t = 0 RLC- (. ... 5 RLC-. : dI q L + RI + = 0 . ... C 1 - C 4 , C 1 - C 3 ; C 4 , , ( 1); -- R1 - R 6 , R1 =120 R3 =2 , - -7 , R 6 ( ) ( 1); -- , ( L RL ) . ... ENTER . ESC, . ... Bx1 1 <<-->>, Bx 2 - C 4 . ... 0.5 , , . ... ENTER>>. : : t 1 - U (t ) = U 0 exp - 2 - U (t ) = U 0 1 - exp t - 1 2 <<ESC>> - - - 10 - , . ... 1983, § 48. ... 1985, § 74. ...

Еще в разделе: (Показать все результаты (>42) - genphys.phys.msu.su/ )

• http://genphys.phys.msu.su/rus/lab/elmag/23M/el-23M.pdf
• http://genphys.phys.msu.su/rus/sci/photonics/PDF/4(en).pdf
• http://genphys.phys.msu.su/rus/sci/photonics/PDF/JETP56.pdf

... Вакансии . ... Commitment: the dedication to achieve your goals - and to continuous professional and personal development . ... HP Graduate Development Program: Our new 18 month Graduate Development Program has been designed to get the most out of the best graduates by giving you the opportunity to gain experience and exposure across HP's businesses. ... HP gives you the opportunity to transition from a brand new graduate to a professional in Sales, Information Technology, Consulting and Marketing. ...

Еще в разделе: (Показать все результаты (>86) - www.physcareer.ru/ )

... Data . ... Models . Solar energetic particles . Paraboloid model . ... Neutron flux variations (RU) . ... This program package is intended to prognose the environment on the board of near-earth elliptic orbiting satellites in the open space as well as behind the Al shielding. ... Next is the required spectrum type (integral or differential). ... sp_x.txt - solar proton spectrum behind shielding, fluence . sn_x.txt - solar neutron spectrum behind shielding, fluence . ... Solar . ...

Еще в разделе: (Показать все результаты (>19) - smdc.sinp.msu.ru/ )

• Space monitoring data center
• APEV service - Space monitoring data center

... Как вы собираетесь вводить ключ в программу шифрования? ... Только имейте в виду, что пароль, вводимый с клавиатуры, можно подсмотреть. Если программа шифрования при вводе пароля отображает его на экране, такой программой лучше не пользоваться. ... Чтобы такого не было, обычно программы шифрования при вводе пароля для зашифрования файла просят ввести пароль дважды. Если пользователь в первый раз ввел один пароль, а во второй раз - другой, значит, по крайней мере один раз он ошибся. ...

Еще в разделе: (Показать все результаты (>320) - www.nature.web.ru/ )

• Хронический гепатит C
• Основные элементы кинематической теории рассеяния рентгеновских лучей

... RIZNICHENKO and T. Yu, PLYUSNINA Biology Faculty of the Lomonosov State University (Received 29 September 1994) The model of transmembrane ion transfer is employed to demonstrate the possibility, in principle, of a non-linearly organized biological system to respond to weak low-frequency electromagnetic radiations (10 Vim, 0.1-100 Hz). The interaction of the biological system of ion transfer with an external electromagnetic field leads to bifurcational changes in the system. ...

Еще в разделе: (Показать все результаты (>39) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/matorin/3399.pdf
• http://library.biophys.msu.ru/PDF/3336.pdf
• http://library.biophys.msu.ru/PDF/3345.pdf

DAYS on DIFFRACTION' 2011 77 Analytical solutions for diffraction problem of nonlinear acoustic wave b eam in the stratified atmosphere Vladimir A. Gusev, Ruslan A. Zhostkow Department of Acoustics, Physical Faculty, Lomonosov's Moscow State University, Russia; e-mail: vgusev@bk.ru The nonlinear wave equation and mo dified Khokhlov­Zab olotskaya typ e equation for high intensive acoustics wave b eams propagating in stratified atmosphere with inhomogeneous of sound sp eed is set up. ...

Еще в разделе: (Показать все результаты (>38) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/dd10proc.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/perehody.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/polosa3.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

ON NONLINEAR DYNAMICS OF THE PENDULUM WITH PERIODICALLY VARYING LENGTH Anton BELYAKOV, Alexander SEYRANIAN a_belyakov@inbox.ru, seyran@imec.msu.ru Institute of Mechanics, Moscow State Lomonosov University, Michurinsky pr. ... Keywords: Pendulum of variable length, Stability of regular rotation, Tumbling chaos, Averaging method, Stability of limit cycle, Quasi-linear oscillatory system, Basin of attraction. ... Fig. ... Thus, the first instability domain takes the form (11) Fig. ... first three terms. ...

Еще в разделе: (Показать все результаты (>10) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/PhysCon2005.pdf
• http://belyakov.imec.msu.ru/papers/Belyakov_rus.pdf
• http://belyakov.imec.msu.ru/papers/ENOC2008.pdf

Magnetism Department MSU . ... Magnetism department . ... Magnetic Laboratory was created in Moscow State University by professor Vladimir Arkad ev. ... In 1918 Arkad ev returned in MSU where he founded Moscow Magnetic Laboratory, which exists for a long time on the enthusiasm of their members. ... As the head of new department professor Nikolay Akulov was assigned. ... During the period since 1954 till 1987 the head of magnetism division was Eugeny Kondorsky. ... Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>8) - magn.phys.msu.ru/ )

... Department of Mathematics, . Faculty of Physics, MSU . ... Differential equations . ... Mathematical analysis 2 . Numerical Methods (A.N. Bogolyubov) . ... Abstract differential equations with applications in mathematical physics . ... Asymptotic methods in nonlinear problems of mathematical physics . ... Methods of finite differences in mathematical physics . ... Inverse problems in mathematical physics . ... Department of Mathematics, Faculty of Physics, Lomonosov MSU 2014-2016 ...

Еще в разделе: (Показать все результаты (>7) - math.phys.msu.ru/ )

... MSU's HPC HISTORY . ... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... X-COM: Distributed Computing Software . ... As it was defined in 2011, when MSU has been awarded by GPU Center of Excellence (formerly CUDA Center of Excellence) status by NVIDIA, our mission is to create, support and constantly improve a complete GPU HPC infrastructure in MSU and even far beyond. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ... Internships at MSU...

Еще в разделе: (Показать все результаты (>70) - hpc.msu.ru/ )

• Welcome to HPC.MSU.RU! | Moscow University Supercomputing Center
• APPLICATIONS: Aerophysics | Moscow University Supercomputing Center

Научная Библиотека . Отдел Обслуживания Физического Факультета МГУ . ... Philosophy & Public Affairs . ... Phys. Rev. A . ... Phys. Rev. Focus . Phys. Rev. Lett. ... Phys. Rev. ST PER . ... Plant and Cell Physiology . Plant Biotechnology Journal . Plant Breeding . Plant Pathology . Plant Species Biology . Plant, Cell & Environment . ... Psychological Science in the Public Interest . ... Научная Библиотека Физического факультета МГУ имени М. В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>9) - wwwlib.phys.msu.ru/ )

Twilight observations with MASS/DIMM B. Safonov Sternberg Astronomical Institute Moscow State University Comprehensive Characterization of Astronomical Sites, 2010 B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 1 / 17 Why observe in twilight with MASS/DIMM? ... ASM includes 3 devices sensitive to background: guider, DIMM and MASS. B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 2 / 17 Background in guider. ...

Еще в разделе: (Показать все результаты (>16) - site2010.sai.msu.ru/ )

• Information

... Basic Linux . ... PCMCIA . Sound . ... CLEVO 8750 running X Window . ... BIOS: Phoenix (256Kb Flash ROM, PnP 1.0a, APM 1.2, LBA) LCD: TFT 13.3" 1024x768 . ... PCMCIA: GL9382; 2x Type II or 1x Type III PC Card slots (with ZV support) . ... Battery: Ni-Mh or Li-Ion . ... Nor X Window neither PCMCIA worked. ... For CLEVO 8750, I found at least two RRs at which X Window works: 62Hz and 70Hz. ... To enable the mouse when working on console use GPM with "-dev/psaux -t ps2" options. ...

Еще в разделе: (Показать все результаты (>10) - uranus.sai.msu.ru/ )

... A Primer from the Reform of Personal Income Taxation in Russia Introduction. ... However, to use the welfare function one needs to aggregate individual preferences that can also be unknown. ... The derivations lead to the conclusion that the optimal marginal income tax rate is increasing as the elasticity of labor supply increases. ... In this paper we obtain the characteristics of the labor supply for different population groups to get the elasticities of labor supply with respect to a post tax...

Еще в разделе: (Показать все результаты (>7) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./vorontchuk.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./ulrich.pdf

... Phys . 40 (2007) 329-342 doi:10.1088/0953-4075/40/2/006 Linear magnetic and alignment dichroism in Auger - photoelectron coincidence spectroscopy F Da Pieve1, S Fritzsche2, G Stefani1 and N M Kabachnik3,4 1 2 3 4 CNISM Institut f Е Fakultat Institute ... Received 20 September 2006, in final form 24 November 2006 Published 3 January 2007 Online at stacks.iop.org/JPhysB/40/329 Abstract Auger - photoelectron coincidence measurements for ... the cross section. ... Phys. Conf. ... Methods Phys....

Еще в разделе: (Показать все результаты (>89) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/Articles_GSIB/nimb_Ar_clasterionbeam.pdf
• http://danp.sinp.msu.ru/LIIWM/JPhysD33_2000_3152Kulikauskas.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb_GCIB_energydistribution.pdf

ERROR: Please enter a valid OpenID.

198. http://temporology.bio.msu.ru/EREPORTS/krugly_discreet-mechanics.pdf

199. Сложно-составные предложения

200. http://lvk.cs.msu.su/~bahmurov/course_realtime/papers/balashov_et_al_eucass2011_monitoring.doc