... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6980) - mouse.belozersky.msu.ru/ )

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>58) - brain.bio.msu.ru/ )

• Other prospects of the change-point based analysis
• Change-points in EEG components with different pattern
• Analysis of change-point synchronization in multi-channel EEG

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>242) - monkey.belozersky.msu.ru/ )

• About this project
• About authors ot this complex
• ETS_all_contacts alignment

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... Octotron: Active Control for Reliable Functioning of Supercomputers . ... DiMMon: a New Approach to Supercomputer Monitoring . ... X-COM: Distributed Computing Software . ... We propose a new approach to building distributed modular monitoring system named DiMMon, both for current and future systems, with an extremely high degree of parallelism. ... Research Computing Center (RCC) of Lomonosov Moscow State University...

Еще в разделе: (Показать все результаты (>69) - hpc.msu.ru/ )

• APPLICATIONS: Theoretical Physics | Moscow University Supercomputing Center
• APPLICATIONS: Astronomy | Moscow University Supercomputing Center
• APPLICATIONS: Mathematics | Moscow University Supercomputing Center

... 2014 August 11 . Rosetta Approaches Comet Churyumov-Gerasimenko . ... Explanation: What does it look like to approach a comet? Early this month humanity received a new rendition as the robotic Rosetta spacecraft went right up to -- and began orbiting -- the nucleus of Comet 67P/Churyumov-Gerasimenko. ... Later this year, Rosetta is scheduled to release the Philae lander , which will attempt to land on Comet Churyumov–Gerasimenko's periphery and harpoon itself to the surface. ... About APOD | ...

Еще в разделе: (Показать все результаты (>8495) - www.sai.msu.su/ )

• APOD: 2011 March 15 - Cassini Approaches Saturn
• APOD: 2014 August 3 - Dark Shuttle Approaching
• APOD: 2010 February 16 - Dark Shuttle Approaching

... Что такое ОТиПЛ? ... Current theory on language contact predicts that different kinds of contact situations will have an impact on different aspects of the language concerned. ... It can be difficult to study the factors involved in the different linguistic outcomes of language contact solely with linguistic methods, as the nature of the contact situation is often not known, especially in cases of prehistoric contact. ... Заседания МТО происходят на филологическом факультете МГУ. ... Новости МТО . ...

Еще в разделе: (Показать все результаты (>312) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/research_interests...

... Block DNA GyrB" shows the score of pairs Lys|Lys, Lys|Arg and Lys|Ser respectively, from a block constituted by amino acid sequences from the same protein (DNAGyraseB), but from different organisms, for example GYRB_ECOLI, GYRB_YERPE (yeast), GYRB_HEINE, GYRB_MUSC (mouse). Block 200 illustrates the score of these pairs from 200 different blocks constituted by sequences from differnet organisms. ... Between the values of single BLock the differences are smaller than between the values of Blosum62. ...

Еще в разделе: (Показать все результаты (>1977) - kodomo.cmm.msu.ru/ )

V.M. Stepanenko, A. Martynov, K.D. Joehnk, M. Perroud, X. Fang, Z.M. Subin, F. Beyrich, A. Nordbo, D. Mironov, J. Huotari. Thermal regime and water - atmosphere interactions of shallow mid-latitude lakes: a case study within the framework of the Lake Model Intercomparison Project. Abstracts of reports on the European Geophysical Union General Assembly 2011, 3 - 8 April 2011, Vienna, Austria . ...

Еще в разделе: (Показать все результаты (>97) - srcc.msu.ru/ )

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>3) - oc.cs.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>181) - www.genebee.msu.ru/ )

• Notes on searching by similarity
• AliGraf - GeneBee Graphical Alignment Help
• GeneBee BLAST 2.2.8 Services Help

... There are many methods for reconstruction of phylogeny from multiple protein sequence alignments. ... In this work we tried to create expert systems that predict: 1) if the data is good for phylogeny reconstruction by Fitch ­ Margolish (FM) method; 2) which method would work better: FM or UPGMA. ... We used two species sets, first containing 27 Fungi species and second containing 25 Metazoa species. ... From the entire set of alignments, two subsets were extracted, called "good" and "bad". ...

Еще в разделе: (Показать все результаты (>261) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/188.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/107.pdf

THE EFFECTIVENESS OF THE SEMIOTIC APPROACH IN ECONOMICS Tarasova N.A. CEMI RAS, Russia, 117418 Moscow, Nakhimovsky prospectus, 499-724-2549, tarasovan2008@yandex.ru The proposed Ch.S. Pierce understanding of semiotics includes a selection of three "hypostases" as a sign of the studied system (syntactics, semantics and pragmatics). ... Effective semiotic approach and created a PhD EB Ershov overall situational theory indices overcome the contradictions of the classical theory of indices. ...

Еще в разделе: (Показать все результаты (>201) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc15764/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc15650/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc15798/doc.pdf

Электронная библиотека Попечительского совета . ... Donaldson S. (ed.), Eliashberg Y. (ed.), Gromov M. (ed.) - Different Faces of Geometry . ... Название: Different Faces of Geometry . Авторы: Donaldson S. (ed.), Eliashberg Y. (ed.), Gromov M. (ed.) . ... Different Faces of Geometry - edited by the world renowned geometers S. Donaldson, Ya. ... Amoebas and Tropical Geometry . ... 3-Dimensional Contact Geometry . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>11823) - lib.mexmat.ru/ )

• Jungnickel R. - Foreign-Owned Firms: Are They Different? :: Электронная
• Lebowitz J.L. - On the equivalence of different order parameters for Ising
• Поиск книг, содержащих applications, completely different :: Электронная

О лаборатории . ... Лаборатория теоретической биофизики . ... PyMol is a powerful drawing instrument and here we show how to plot Fukui function with PyMOL after two calculation steps with FireFly (PC-GAMESS). continue reading.. ... Given a molecular object name and QM part selection name (which can be defined using either approach available in PyMol) it generates output file with corresponding input groups. ... All-atom automatic OPLS-AA topology generator . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>57) - erg.biophys.msu.ru/ )

• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория
• Visual approach to construction of &QMMM section of CP2K input file ERG
• comcon1 ERG Research Group: Лаборатория теоретической биофизики

Next: One example Up: No Title Previous: No Title . Wavelets are versatile tools of harmonic analysis. Because of their many uses, the word `wavelet' comes with different connotations (and different promises) to users in different fields. ... To pursue the analogy, one may wish to select from the data some contact surfaces with specific finish tolerances. the amount of information is then reduced by selection and/or by statistical means. ...

Еще в разделе: (Показать все результаты (>3172) - crydee.sai.msu.ru/ )

• Different Fortran standards
• Image: Coast is pretty different here -- from beaches to unclimbable rocks.
• Commentary

... Twenty-four-hour observations on the behavior of white water-lily ( Nymphaea candida Presl.) flowers were conducted. The observations were made during different photoperiods in the Middle Russia (natural photoperiod, light flash in the dark daytime, absence of light daytime) and in the Northern Karelia (polar day). ... Movements of water-lily flowers appear to serve for pollination optimization. ...

Еще в разделе: (Показать все результаты (>191) - herba.msu.ru/ )

• International Journal on Algae Vol.3., No.1. 2001
• The variability of different Drosera
• Systema Naturae

... Previous message: [RU-NGI] Different NAGIOS test results from CERN and SINP . Next message: [RU-NGI] Different NAGIOS test results from CERN and SINP . Messages sorted by: [ date ] [ thread ] [ subject ] [ author ] . ... Насколько я знаю, сейчас уже используется только результат nagios из НИИЯФ МГУ, на ЦЕРНовский можно не обращать внимание. ... RU-NGI mailing list > RU-NGI at theory.sinp.msu.ru > http://theory.sinp.msu.ru/mailman/listinfo/ru-ngi > -- Best regards, Valery Mitsyn . ...

Еще в разделе: (Показать все результаты (>594) - theory.sinp.msu.ru/ )

• intas:cern-intas03:task5 [THEP]

... Due to the different network transport used, NNTP provides for a vastly different approach to news exchange from C-news. ... It is based on a stream-oriented connection-- usually over TCP-- between a client anywhere in the network, and a server on a host that keeps netnews on disk storage. The stream connection allows the client and server to interactively negotiate article transfer with nearly no turnaround delay, thus keeping the number of duplicate articles low. ... This is called news faking . ...

Еще в разделе: (Показать все результаты (>294) - itpm.msu.su/ )

• Different Streaks of Development
• Other Types of Hardware
• Multi-Processing Modules (MPMs) - Apache HTTP Server

. There are several different shells available for Unix; the most popular are described here. You can use any one of these shells if they are available on your system. And you can switch between the different shells once you have found out if they are available. Bourne shell (sh) . C shell (csh) . TC shell (tcsh) . Korn shell (ksh) . Bourne Again SHell (bash) .

Еще в разделе: (Показать все результаты (>132) - comet.sai.msu.ru/ )

• Using a different printer
• Example of using a different printer
• Different types of file