... 3 from allpy import protein . 4 from allpy.data import codes . ... 9 def freq ( monomer ): . 10 amount = freqs . get ( monomer ) . 11 if amount : . ... 15 aln = protein . ... 16 monomers = [ code1 for code1 , modified , _ , _ in codes . ... 17 monomers += [ "-" ] . ... join ( map ( str , monomers )) . ... 21 freqs = {} . 22 for monomer in column : . 23 if monomer : . 24 monomer = monomer . ... 27 freqs [ monomer ] = freqs . ... join ( map ( str , map ( freq , monomers ))) . ...

Еще в разделе: (Показать все результаты (>49185) - kodomo.fbb.msu.ru/ )

• allpy: f61814d8bef5 utils/freqs.py
• allpy: 8afd162cf7cb utils/freqs.py
• allpy: 8405ddf8f8c1 utils/freqs.py

SVETKA, a program for analysis of different alignments . Back to the help page . ... Such a feature can look like " Leucine in the position 362 of the alignment of the entire family " and can, in many cases, be a "decision rule" to distinguish sequences from two sides of a tree branch. ... Comparing the alignment with an input tree (the tree may be entered by the user or reconstructed with the WPGMA algorithm), the program detects supporting positions of the alignment for every branch the tree. ...

Еще в разделе: (Показать все результаты (>6311) - monkey.belozersky.msu.ru/ )

• SDP home page
• Inquiry information || Parsimony algorithm

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>362) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/83.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/214.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/17.pdf

Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>1952) - www.sai.msu.su/ )

• Light Curve Templete/Observing Form For Visual SNe Observers.
• SAL- Other Scientific Fields - Chemistry, Biology Related - Dotter
• SAL- Other Scientific Fields - Chemistry, Biology Related - GRS

... Measurement of B-type natriuretic peptide by two assays utilizing antibodies with different epitope specificity. ... DESIGN AND METHODS: Plasma samples (n=94) from HF patients were analyzed by the novel-type "Single Epitope Sandwich" (SES assay prototype) and the conventional-type Siemens ADVIA Centaur BNP assays. ... RESULTS: The SES assay measured 1.2- to 7.2-fold (2.1+/-0.9; mean, SD) greater BNP concentrations compared to the Siemens assay. ...

Еще в разделе: (Показать все результаты (>78) - biochem.bio.msu.ru/ )

... Lathrop R.H., Rogers Jr R.G., Smith T.F. - A Bayes-optimal sequence-structure theory that unifies protein sequence-structure recognition and alignment . ... Название: A Bayes-optimal sequence-structure theory that unifies protein sequence-structure recognition and alignment . Авторы: Lathrop R.H., Rogers Jr R.G., Smith T.F. Аннотация: . A rigorous Bayesian analysis is presented that unifies protein sequence-structure alignment and recognition. ...

Еще в разделе: (Показать все результаты (>112746) - lib.mexmat.ru/ )

• Althaus E. - A branch-and-cut algorithm for multiple sequence alignment ::
• Forta B. - MySQL Crash Course :: Электронная библиотека попечительского совета
• Hartle T. - Comparing Indicators: Stochastics %K versus Williams' %R ::

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>237) - www.genebee.msu.ru/ )

• BLAST Basic Overview
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee BLAST 2.2.8 Services

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>36) - mouse.genebee.msu.ru/ )

• ConClus

FASTA /TFASTA/FASTX/TFASTXv3(1) FASTA /TFASTA/FASTX/TFASTXv3(1) NAME fasta3, fasta3_t - scan a protein or DNA sequence library for similar sequences tfasta3, tfasta3_t - compare a protein sequence to a DNA sequence library , translating the DNA sequence library `on-the-fly'. fastx3, fastx3_t - compare a DNA sequence to a protein sequence ... REF_URL the format string used to define the option to lookup the library sequence in entrez, or some other database. ...

Еще в разделе: (Показать все результаты (>4218) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/index.html
• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/megablast.html
• Множественное выравнивание.

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• RNA Alignment
• SDPlight
• Input Formats

... 46. to give account of... 47. current (n.,adj.) . ... 57. complete v. adj. ,completely . ... 88. equal (v, adj), equally . ... 127. involve, involved (p.I, adj) . ... 134. to mean, meaning (less), means, by means of, mean (adj) . ... 145. reciprocal ( reciprocal relation) . ... 153. result, as a result, to result in / result from . ... 173a. reciprocal ( reciprocal relation) . ... Некоторые часто используемые слова: . ... новости студенты преподаватели лаборатории интернет-олимпиада по химии . ...

Еще в разделе: (Показать все результаты (>2) - www.students.chemport.ru/ )

Astronomy Picture of the Day . La Palma Eclipse Sequence . ... Credit Copyright: Miguel Claro ( TWAN ) Explanation: At left, a dramatic image sequence follows late September's total lunar eclipse above a rugged landscape and sea of clouds from the Canary island of La Palma . Composited in a circular fisheye projection, the brightness of the Full Perigee Moon changes drastically in transition from outside the total eclipse phase compared to its dim glow during the 72 minute long totality . ...

Еще в разделе: (Показать все результаты (>7342) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > La Palma Eclipse Sequence
• Gamma Ray Earth

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6989) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• PLANdbAffy: probe-level annotation database for Affymetrix expression
• S : rm_systems

... Synthesis of Tritium Labeled Compounds Using Fibroid Carbon Carrier . Abstract The results of tritium labeling of organic compounds by solid phase catalysis using multi-walls carbon nanotubes were compared with one obtained by using activated carbon purchased from “Norit”. ... Moscow University Chemistry Bulletin . 2010, Vol. ... 2, P. 128 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>526) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 50, No. 6, P. 411 (2009)
• Moscow University Chemistry Bulletin Vol. 49, No. 3, P. 163 (2008)
• Moscow University Chemistry Bulletin Vol. 48, No. 6, P. 386 (2007)

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Compare Best Prices . ... Online Status: Offline . ... So if you are a highway driver, you may also not be able to appreciate how much money you save with a hybrid car. consulting business, you must be widely knowledgeable. ... Take Surveys And Make Money website here get moneys worth phrase . ... Taking Surveys Online Online Surveys For Money Scams Get Survey Sites Take Online . ... Earn Money By Online . ...

Еще в разделе: (Показать все результаты (>4631) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Compare Prices
• Экологический Форум - Фундаментальная Экология: whilst utilizing cheekbones
• Экологический Форум - Фундаментальная Экология: Chandon compare Oakley, luxury

PHP Manual . ... PHP 4 >= 4.1.0) version_compare -- Compares two "PHP-standardized" version number strings . int version_compare ( string version1, string version2 [, string operator]) . version_compare() compares two "PHP-standardized" version number strings. ... Example 1. version_compare() Example . prints -1 echo version_compare("4.0.4", "4.0.6"); // these all print 1 echo version_compare("4.0.4", "4.0.6", "<"); echo version_compare("4.0.6", "4.0.6", "eq"); . ...

Еще в разделе: (Показать все результаты (>240) - oit.cmc.msu.ru/ )

• mcal_date_compare
• ldap_compare
• dbx_compare

. You can compare any two versions of a file that is under the control of SCCS with the sccsdiff command: /usr/sccs/sccsdiff -r version -r version s. filename . Using this command produces a line by line difference between the two versions of the file. Results are shown in the same format as that produced by the diff command. Examples .

Еще в разделе: (Показать все результаты (>80) - comet.sai.msu.ru/ )

• Comparing directories
• Comparing files
• Examples of comparing files with the sccsdiff command

... Dynamic Host Configuration Protocol · · - : ­ DHCP (UDP:67) ­ ( , IP , , DNS-) ­ DHCP (UDP:68) ­ DHCP netstat -pan | ... CLI_IP ping · ping ­ (Echo Request) ­ (Echo Reply) ICMP · . ... Domain Name System ( DNS ) · · DNS - · (, IP (A, AAAA)) · DNS UDP :53 DNS ip domain-name DNS - server : nslookup domain-name [ DNSserver ] dig [@ DNS - server ] domain name domain-name ip arpa: ya.ru (93.158.134.3) dig 3.134.158.93.in-addr.arpa dig 8.8.8.8.in-addr.arpa iperf iperf e2e iperf udp ...

Еще в разделе: (Показать все результаты (>8) - lvk.cs.msu.su/ )

... A numerical algorithm for the analysis of viscoelastic waves in the Kelvin-Voigt medium" . Sadovskii V.M. and Sadovskaya O.V. A numerical algorithm for solving dynamic problems in the theory of the viscoelastic Kelvin-Voigt medium is proposed on the basis of Ivanov's method of constructing difference schemes with prescribed dissipative properties. ... The algorithm is tested by solving the problem of traveling surface waves. ... PDF (Full text in Russian, References in English) (753KB) . ...

Еще в разделе: (Показать все результаты (>572) - num-meth.srcc.msu.ru/ )

• An approach for constructing one-point iterative methods for solving nonlinear
• "Optimization algorithms for facet models and methods of their network...
• "Sink-algorithms for the simulation of electron transfer kinetics"

REPORT ON INTERNATIONAL SOIL SCIENCE CONGRESS (Montpellier, France, August 1998). ... The symposium was concerned with the effects of environmental factors on soil properties and with reconstructing past environments from soil properties. ... Several of the papers assessed the rates of these processes, some of which are matters of international concern for future global food production because they are causing rapid soil degradation. ...

Еще в разделе: (Показать все результаты (>139) - www.fadr.msu.ru/ )

• THE POST-SIMPOSIUM EXCURSION (July 31 - August 7,1998)
• SPECIAL ISSUE OF CATENA «RECONSTRUCTION AND CLIMATIC IMPLICATIONS OF PALEOSOLS»