Найдено документов: 5 ---- Время поиска: 0.79сек. |
Каталог астрономических ресурсов
1. http://kodomo.cmm.msu.ru/~lynx/term7/text/stat.pdf
... All manipulations henceforth described occurred either at 4 °C or on ice. ... The phenylalanines reside in unambiguous density, and in both subunits, the ring appears to cap -helix c (Figs. 1 and 2). ...
[
Текст
]
Ссылки http://kodomo.cmm.msu.ru/~lynx/term7/text/stat.pdf -- 936.5 Кб -- 21.10.2012
Похожие документы
Похожие документы
2. http://kodomo.cmm.msu.ru/~julia270692/term2/query_add2.txt
... PubMed PMID: 19852188. 11: Jayaraman KS. Transgenic aubergines put on ice. Nature. 2009 Oct 22;461(7267):1041. ... 2002 Aug;20(8):756-7. PubMed PMID: 12147985. 793: Bogged down in CAP reform. Nat Biotechnol. 2002 Aug;20(8):753. ...
[
Сохраненная копия
]
Ссылки http://kodomo.cmm.msu.ru/~julia270692/term2/query_add2.txt -- 155.7 Кб -- 03.03.2010
Похожие документы
Похожие документы
3. http://kodomo.cmm.msu.ru/~mashunia/query_add2.txt
... planta but also for the loss of cap binding ability in vitro, the principal function ... the CaMV35S promoter (35Sp) or a root cap promoter (RCp), on Arabidopsis growth ...
[
Сохраненная копия
]
Ссылки http://kodomo.cmm.msu.ru/~mashunia/query_add2.txt -- 2314.9 Кб -- 21.05.2008
Похожие документы
Похожие документы
4. http://kodomo.cmm.msu.ru/~alex2308/lac/Xanthomonas_campestris.fasta
Астронет | Научная сеть | ГАИШ МГУ | Поиск по МГУ | О проекте | Авторам
>sp|B0RUZ7|3HAO_XANCB 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=xcc-b100_2705 PE=3 SV=1 MLVPPINLHAWVEQHRHLLKPPVGNKCIQQDGFIIMIVGGPNARTDYHYDEGPEWFFQLE...
[
Сохраненная копия
]
Ссылки http://kodomo.cmm.msu.ru/~alex2308/lac/Xanthomonas_campestris.fasta -- 2043.6 Кб -- 19.05.2010
Похожие документы
Похожие документы
5. http://kodomo.cmm.msu.ru/~golikov_v/xc.fasta
>sp|B0RUZ7|3HAO_XANCB 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=xcc-b100_2705 PE=3 SV=1 MLVPPINLHAWVEQHRHLLKPPVGNKCIQQDGFIIMIVGGPNARTDYHYDEGPEWFFQLE...
[
Сохраненная копия
]
Ссылки http://kodomo.cmm.msu.ru/~golikov_v/xc.fasta -- 2086.4 Кб -- 24.05.2010
Похожие документы
Похожие документы
Астронет | Научная сеть | ГАИШ МГУ | Поиск по МГУ | О проекте | Авторам
Комментарии, вопросы? Пишите: info@astronet.ru или сюда