Поиск по:www.genebee.msu.ru -
Поискать по всем серверам
На этой странице приведены все страницы сервера www.genebee.msu.ru ,которые мы индексируем. Показаны документы 1 - 20 из 363.
Упорядочить по:
URL
|
дате изменения
1. Bioinformatics portal, Moscow State University
... Bioinformatics Portal . GeneBee . ... Bioinformatics Portal of A.N.Belozersky Institute, . Moscow State University . Supported by the Russian Foundation for Basic Research, grant 13-07-00969-a . Original Services of GeneBee Group . Databanks screening . Sequence analysis . Screening by keywords . AliBee Multiple alignment Release 3.0 . AliGraf Graphical Alignment . AliComp Alignments Comparison . Screening by similarity Release 3.0 . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/bioinformatics.html -- 10.2 Кб -- 15.01.2016
Похожие документы
Похожие документы
2. Screening by Keyword then by Similarity
... Screening by Keyword then by Similarity . ... Protein banks . SWISSPROT protein databank TREMBL protein databank . ... Query Keyword string You can use here any keywords and 'or' , 'and' and 'andnot' logical operators. Query sequence (without name) . Examples of the Query Keywords: . proteinase cleave . DE [proteinase] AND cleave (could be written as: DE [proteinase] cleave) . DE [proline] DE [endopeptidase] ) OR ( KW [proteinase] DE [cleave] ) . XX[A$b5] ANDNOT cleave . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/scr_key_sim.html -- 8.7 Кб -- 03.07.2015
Похожие документы
Похожие документы
3. Screening by similarity
... Advanced Screening by Similarity . ... Simple Query Form . Protein databanks: . ... Motif's length . threshold . Motif's power threshold . Alignment's power . ... of query sequence . End position of query sequence . ... Threshold of motif's . ... Threshold of alignment's . ... DNA/RNA Blosum 30 Blosum 50 Blosum 62 Dayhoff Johnson . ... Yes No . ... Sequence Alignment . ... Query sequence name . Enter or Paste here your Sequence without name OR Alignment . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/scrsim_full.html -- 12.3 Кб -- 03.07.2015
Похожие документы
Похожие документы
4. Screening by similarity
... Basic Screening by Similarity . ... Full Query Form . ... Protein databanks: . SWISSPROT protein databank TREMBL protein databank . ... DNA/RNA Blosum 30 Blosum 50 Blosum 62 Dayhoff Johnson . Query sequence name . ... Query Sequence (without name) OR Alignment . ... FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSR FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSR KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIF FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/scrsim_reduced.html -- 7.2 Кб -- 03.07.2015
Похожие документы
Похожие документы
5. screening by keywords
... Screening by Keywords . Protein databanks . SWISSPROT protein databank TREMBL protein databank . ... Receive bank sequences . Yes No . Receive 3D coordinate . ... Query string You can use here any keywords and 'OR' , 'AND' and 'ANDNOT' logical operators. ... proteinase cleave . DE [proteinase] AND cleave (could be written as: DE [proteinase] cleave) . DE [proline] DE [aminopeptidase] ) OR ( KW [proteinase] DE [cleave] ) . XX[A$b5] ANDNOT cleave . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/services/scrkeyw_full.html -- 7.1 Кб -- 03.07.2015
Похожие документы
Похожие документы
6. TAU-MSU :: Quality control, ORF detection and gene annotation of Paenibacillus
... TAU-MSU project . ... TAU-MSU . Quality control, ORF detection and gene annotation of Paenibacillus dendritiformis and Paenibacillus vortex genomes: . ... flowgram based quality control of contig positions and fragments . the detection of the poor quality segments of contigs . ... the extrinsic and intrinsic algorithms based prediction of ORFs . iterative correction of assembly in order to improve ORF prediction for both genomes . gene annotation by A4 algorithm . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/~nikonov/TAUMSU/ -- 10.2 Кб -- 27.02.2014
Похожие документы
Похожие документы
7. INTAS :: Global and Local Protein Matching
... Protein Dynamics as Determinant of Function. ... Graph Matching with Dual-Step EM algorithm. IEEE Trans. ... A Graduated Assignment Algorithm for Graph Matching. ... Protein Structure Compaison by Alignment of Distance Matrices. ... Protein Structure: Insights from Graph Theory. ... Global and Local Protein Matching . A novel method for protein comparison based on EM-SVD (Expectation Maximization - Singular Value Decomposition) will be developed both for global and local similarities. ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/~nikonov/INTAS/ -- 20.2 Кб -- 27.02.2014
Похожие документы
Похожие документы
8. IGLA-3D :: Global and Local Protein Matching
. IGLA-3D service . Documentation . Home . # . File name . File size, bytes . PDB target . Chain . 1 . Select local file . or generate it from the following 4-letter identifier . (e.g. 2asr matches pdb2asr.ent file) . 2 . Select local file . or generate it from the following 4-letter identifier . (e.g. 2asr matches pdb2asr.ent file) . Send results to . Comments and bug-reports send to: nik@genebee.msu.su
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/~nikonov/IGLA/ -- 11.3 Кб -- 27.02.2014
Похожие документы
Похожие документы
9. GeneBee
A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/ -- 7.1 Кб -- 05.01.2014
[ Сохраненная копия ] Ссылки http://www.genebee.msu.ru/index.html -- 7.1 Кб -- 05.01.2014
Похожие документы
[ Сохраненная копия ] Ссылки http://www.genebee.msu.ru/index.html -- 7.1 Кб -- 05.01.2014
Похожие документы
10. sponsor
... Первыми спонсорами конкурса стали Общество Роберта Коха (Германия) и Фонд Рейна (Великобритания). ... Спонсорами конкурсов были: компания Никамед-Амершам (1995-1998), Фонд Рейна (Великобритания, 1993-1999), Общество Роберта Коха (Германия, 1993-1997), господин Томас Мэнн (частное лицо, США, 1996-1997), Датское физическое общество (1994), Археологическое общество Греции (1994), Шведский Институт (1998 г.), господин Дж. ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/EAprize/sponsor.htm -- 16.2 Кб -- 19.12.2013
Похожие документы
Похожие документы
11. rusclub
О Европейской Академии . ... В марте 1992 г. В.П. Скулачев (академик РАН, директор НИИ физико-химической биологии, декан факультета биоинженерии и биоинформатики Московского Государственного Университета), будучи избран членом Президиума Академии, предложил создать клуб ее российских членов. ... Первым серьезным делом клуба стал конкурс молодых российских ученых на соискание премий Европейской Академии. ... Правила конкурса были разработаны клубом и утверждены Президиумом Европейской Академии. ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/EAprize/rusclub.htm -- 8.4 Кб -- 19.12.2013
Похожие документы
Похожие документы
12. news
. О Европейской Академии . Наши спонсоры . Правила оформления заявки . Лауреаты 2012 года . Церемония награждения . Информация о новых конкурсах . Новый конкурс еще не объявлен . Телефон 8-495-939-48-04 . (Шаповалова Ирина, с 14 до 17 в рабочие дни) . МГУ, Лабораторный корпус Б, комн. 113 . Последнее обновление - 19.12.2013 г .
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/EAprize/news.htm -- 15.8 Кб -- 19.12.2013
Похожие документы
Похожие документы
13. pobed42
... Акимова Ольга Алексеевна, 1980, Биологический факультет МГУ имени М.В. Ломоносова, "Смерть эпителиальных и эндотелиальных клеток, вызванная кардиотоническими стероидами: идентификация Na+i,K+i-независимого сигнального каскада, опосредованного активацией р38 MAPK" . Алехина Ольга Михайловна, 1980, Институт белка РАН; "Кинетические параметры инициации трансляции в эукариотических системах" . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/EAprize/pobed42.html -- 3.9 Кб -- 19.12.2013
Похожие документы
Похожие документы
14. pobed41
... Грабовский Андрей Владимирович, 1981, Институт ядерной физики СО РАН им. Г.И. Будкера, "Описание полужестких процессов в физике элементарных частиц" . ... Химия : . Адонин Сергей Александрович, 1987, Институт неорганической химии им. А.В. Николаева СО РАН, "Комплексы полиоксовольфраматов с благородными металлами" . ... Грайфер Екатерина Дмитриевна, 1985, Институт неорганической химии имени А.В. Николаева СО РАН, "Высокорасщепленный графит, графен, их производные и родственные слоистые материалы" . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/EAprize/pobed41.html -- 3.9 Кб -- 19.12.2013
Похожие документы
Похожие документы
15. List of Publications
... List of publications of Dr. Vitaliy B. Borisov . ... Borisov V.B. , Smirnova I.A., Krasnosel`skaya I.A., Konstantinov A.A. Oxygenated cytochrome bd from Escherichia coli can be converted into the oxidized form by lipophilic electron acceptors. ... Vos M.H., Borisov V.B. , Liebl U., Martin J.-L., Konstantinov A.A. Femtosecond resolution of ligand-heme interactions in the high-affinity quinol oxidase bd : a di-heme active site? ... Evidence that only a small fraction of heme b 595 reacts with CO. ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/EAprize/example.htm -- 67.2 Кб -- 06.02.2013
Похожие документы
Похожие документы
16. project
ПРАВИЛА ПОДАЧИ ЗАЯВОК НА УЧАСТИЕ В КОНКУРСЕ . Материалы на конкурс представляются непременно в двух вариантах: в печатном виде (на русском языке, по почте) и электронном виде (на английском языке, по электронной почте). ... Текст письма должен содержать данные титульного листа на английском языке, в виде приложения - файл формата doc или rtf с текстом заявки (пп. 1-6, без титульного листа, в одном файле) и отдельный файл с титульным листом на русском языке. ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/EAprize/project.html -- 5.6 Кб -- 06.02.2013
Похожие документы
Похожие документы
17. foto2
. 1 2 3 4 5 6 7 8
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/EAprize/foto1.html -- 1.6 Кб -- 28.12.2012
[ Сохраненная копия ] Ссылки http://www.genebee.msu.ru/EAprize/foto2.html -- 1.6 Кб -- 28.12.2012
[ Сохраненная копия ] Ссылки http://www.genebee.msu.ru/EAprize/foto3.html -- 1.6 Кб -- 28.12.2012
Похожие документы
[ Сохраненная копия ] Ссылки http://www.genebee.msu.ru/EAprize/foto2.html -- 1.6 Кб -- 28.12.2012
[ Сохраненная копия ] Ссылки http://www.genebee.msu.ru/EAprize/foto3.html -- 1.6 Кб -- 28.12.2012
Похожие документы
18. The GeneBee Group
... Search The Server . ... The Russian Users Of The GeneBee Package . ... Up to 1995 several versions of the package were installed on personal computers in many institutions working in the field of the molecular biology. ... Institute of Molecular Biology, RAS . ... In May 1995 the GeneBee Group build the first version of web-server, which slowly becomes popular in worldwide molecular and biology society. ... In 1992 the GeneBee Group establish contacts with Oxford laboratory of molecular biology. ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/history.html -- 28.2 Кб -- 06.11.2012
Похожие документы
Похожие документы
19. GeneBee BLAST 2.2.22+ Services .
About Blast 2.2.22+ . Blast FAQ . Basic options . ... Choose Database : . ... Choose taxon . ... Advanced options . Choose filter : . ... Other advanced options : . Format options . ... Pairwise Query-anchored showing identities Query-anchored no identities Flat query-anchored, show identities Flat query-anchored, no identities Query-anchored no identities and blunt ends Flat query-anchored, no identities and blunt ends . Descriptions : 0 10 50 100 . Alignments : 0 10 50 100 . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/blast_2.2.22/blastform.php?program=tblastx -- 8.3 Кб -- 01.10.2012
Похожие документы
Похожие документы
20. GeneBee BLAST 2.2.22+ Services .
About Blast 2.2.22+ . Blast FAQ . Basic options . ... Choose Database : . ... Choose taxon . ... Advanced options . Choose filter : . ... Other advanced options : . Format options . ... Pairwise Query-anchored showing identities Query-anchored no identities Flat query-anchored, show identities Flat query-anchored, no identities Query-anchored no identities and blunt ends Flat query-anchored, no identities and blunt ends . Descriptions : 0 10 50 100 . Alignments : 0 10 50 100 . ...
[
Сохраненная копия
]
Ссылки http://www.genebee.msu.ru/blast_2.2.22/blastform.php?program=tblastn -- 8.3 Кб -- 01.10.2012
Похожие документы
Похожие документы