... Reserved Keys . ... The following keys are reserved. An implementation is not required to interpret these keys, but if it does interpret the key, it must provide the functionality described. { host} . Value is a hostname. The format of the hostname is determined by the implementation. { arch} . ... The format of path is determined by the implementation. { file} . ... The format of the filename and internal format of the file are determined by the implementation. { soft} . ... Центры . ...

Еще в разделе: (Показать все результаты (>247) - www.parallel.ru/ )

• Spawn Example | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Reserved Key Values | PARALLEL.RU - Информационно-аналитический центр по

PHP Manual . Prev . Next . Here is the list of PHP reserved words, usually constants and predefined variables . You won't find any functions here, but rather language constructs. You shouldn't try to use such names as variable, function, constant or method names, as it will surely lead to confusion. and . ... old_function . ... argc . ... PHP_OS . ... PHP_SELF . ... PHP_VERSION . ... function . ... HTTP_SERVER_VARS . ... list() . ... List of Function Aliases . ...

Еще в разделе: (Показать все результаты (>483) - oit.cmc.msu.ru/ )

... All rights reserved finmen.spa@mail.ru : : hcp://spa.msu.ru/page_325.html : hcp://vk.com/mh_msu_fgu_finance .. ... All rights reserved / () · : · : LIBOR ( London Interbank Offered Pate), MIBOR ( Moscow Interbank Offered Pate) · :LIBID (London Interbank Bid), MIBID (Moscow Interbank Bid) · : MIACR (Moscow Interbank Ac·al Credit Rate) · : Prime- rate, Mosprime- rate .. ... All rights reserved · ­ , t i B ­ D =- - - - - - - - - - - - - - t - 360 i - , 100% · .. ... All rights reserved · , · APR ­ , . ...

Еще в разделе: (Показать все результаты (>32) - www.spa.msu.ru/ )

• http://www.spa.msu.ru/uploads/files/bakalavriat/lecture_2702_finance_analysis.pdf
• http://www.spa.msu.ru/uploads/files/bakalavriat/lecture_2002_finance_analysis.pdf

Планеты во Вселенной . Курс лекций для студентов астрономического отделения . Есть ли основания полагать, что планеты являются распространенным явлением во Вселенной? Может ли служить наша Солнечная система типичным примером или она уникальна? ... Эта странная Солнечная система . ... Так рождаются планеты? ... Отдела исследований Луны и планет: . ... к.ф.м.н. Ж.Ф.Родионова . к.ф.м.н. В.В.Бусарев . ... Карты Меркурия Ж.Ф.Родионова . ... Карты Луны Ж.Ф.Родионова . ... Луны и планет . ...

Еще в разделе: (Показать все результаты (>157) - selena.sai.msu.ru/ )

• Mikhail V. Goryachev
• Луноход1
• Фото из архива Глушко

... Previous message: [Ru-ngi] Fwd: [Noc-managers] Please add EGI voms servers for dteam to your site configuration . Next message: [RU-NGI] Fwd: [Noc-managers] Clarification for: Please add EGI voms servers for dteam to your site configuration . ... Please update your configuration no later than December 12th 2010 > according to point 2 at http://wiki.egi.eu/wiki/Dteam_vo . CiC portal > also contains the new voms servers. ... More information about the RU-NGI mailing list . ...

Еще в разделе: (Показать все результаты (>32188) - theory.sinp.msu.ru/ )

• [RU-NGI] Fwd: [Noc-managers] Switching ops VOMS server next week
• [RU-NGI] Fwd: [Noc-managers] Switch DNS server for egi.eu domain
• [RU-NGI] Fwd: [Noc-managers] Clarification for: Please add EGI voms servers for

Listing of CSS class names emitted from TWiki core code and standard plugins, for the Dakar release. ... TWiki styles in core code . TWiki Styles in Plugins . ... TWiki Styles in Templates . ... Most html elements generated by TWiki core code now have Cascading Style Sheet (CSS) tags. Skin builders and others who want to change the appearance of the default TWiki installation or any of the skins can use this document to see what styles can be created for these html elements. ...

Еще в разделе: (Показать все результаты (>35146) - dualopt1.cmm.msu.ru/ )

• TWikiCss - TWiki - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki
• %TOPICTITLE% (6 vs. 7) - TWiki

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Удаленный Task Manager для NT4 Server . ... Re: Удаленный Task Manager для NT4 Server [ re: Kraft ] . ... Re: Удаленный Task Manager для NT4 Server [ re: blind ] . ...

Еще в разделе: (Показать все результаты (>55001) - www.fds-net.ru/ )

• Продам Microsoft Action Pack [подробности инсайд] - Public forum of MSU united

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ­ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : « , - ». Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>55) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/venturecapital_rus.pdf
• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf

Next: Persistent Objects Up: POA Previous: Example . ... The former one is called when a new servant needs to be incarnated to serve a previously unknown Object Id. etherealize is called when the servant is deactivated (for example in POA shutdown) and allows the servant manager to clean up associated data. class AccountManager : public virtual POA _ PortableServer ::ServantActivator { /* declarations */ }; PortableServer :: Servant AccountManager::incarnate (/* params */) { return ...

Еще в разделе: (Показать все результаты (>730) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QWindow Class
• Persistent Objects
• Qt Toolkit - biff/biff.cpp example file

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>19843) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2606.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc5398.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc5398.txt

Московский государственный университет имени М.В.Ломоносова Основан в 1755 году . ... МГУ имени М.В.Ломоносова . ... 8 апреля 2016 года в Ломоносовском корпусе МГУ имени М.В.Ломоносова состоялась церемония награждения победителей и призеров олимпиады ?Покори Воробьевы горы!? ... 6 апреля 2016 года в МГУ состоялся очередной концерт из цикла ?Ректор Московского университета приглашает?? ... Московский государственный университет имени М.В.Ломоносова . ... Copyright 1997?2016 МГУ имени М.В.Ломоносова . ...

Еще в разделе: (Показать все результаты (>48) - www.msu.ru/ )

Modules | Directives | ... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . ... Description: . Content cache storage manager keyed to URIs . ... Experimental . ... disk_cache_module . ... This module is experimental. Documentation is still under development... mod_disk_cache implements a disk based storage manager. ... If the mod_disk_cache module has been loaded or compiled in to the Apache server, this directive must be defined. ...

Еще в разделе: (Показать все результаты (>560) - itpm.msu.su/ )

• mod_cache - Apache HTTP Server
• htpasswd - Manage user files for basic authentication - Apache HTTP Server
• dbmmanage - Manage user authentication files in DBM format - Apache HTTP Server

Modules | Directives | ... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . Description: . Content cache storage manager keyed to URIs . ... Experimental . ... disk_cache_module . ... This module is experimental. Documentation is still under development... mod_disk_cache implements a disk based storage manager. ... If the mod_disk_cache module has been loaded or compiled in to the Apache server, this directive must be defined. ...

Еще в разделе: (Показать все результаты (>1557) - uneex.lorien.cs.msu.su/ )

• mod_mem_cache - Apache HTTP Server
• htpasswd - Manage user files for basic authentication - Apache HTTP Server
• dbmmanage - Manage user authentication files in DBM format - Apache HTTP Server

... This section lists many database related software tools and utilities. ... Utilities Other DBMS ( Commercial, Shareware, GPL ) . barracuda -- a BibTeX database manager. ... C/Database Toolchest -- a C/C++ library with database management functions. C/Base -- a 4GL database application development system. ... KnowledgeSEEKER -- data analysis and prediction system from database. locus -- a fulltext database engine for Linux. ... VisDB -- a visual data mining and database exploration system. ...

Еще в разделе: (Показать все результаты (>3569) - www.sai.msu.su/ )

• SAL- Database Systems - Relational DBMS - Essentia
• SAL- Database Systems - Utilities Other DBMS - MPSQL
• SAL- Database Systems - Utilities Other DBMS - Raima Products

... О физическом факультете . ... Журнал "Ученые записки физич. факультета МГУ" . ... Журнал "Ученые записки физического факультета МГУ" . ... Секция физики конференции "Ломоносовские чтения" будет работать на физическом факультете с 18 по 27 апреля 2016 г. 15.04.2016 Конференция проектных и исследовательских работ школьников 'От атома до галактики' . ... Заседания секции "Физика" конференции студентов, аспирантов и молодых ученых "Ломоносов 2016" на физическом факультете состоятся 14 апреля. ...

Еще в разделе: (Показать все результаты (>108) - phys.msu.ru/ )

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>663) - kodomo.cmm.msu.ru/ )

• projects
• Term1
• Term4

Электронная библиотека Попечительского совета . ... Piltzecker T. - How to Cheat at Managing Microsoft Operations Manager 2005 . ... Название: How to Cheat at Managing Microsoft Operations Manager 2005 . Автор: Piltzecker T. Аннотация: . ... A users guide to Microsoft Operations Manager (MOM) enabling a cost reduction and simplification in managing your Windows Server System Infrastructure . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>6375) - lib.mexmat.ru/ )

• Snedaker S. - How to Cheat at Managing Windows Small Business Server 2003 ::
• Herington D., Jacquot B. - The HP Virtual Server Environment: Making the
• Pedersen A. - Web Host Manager Administration Guide :: Электронная библиотека

Boat tour and banquet on Moskva River . ... We have reserved a boat which goes by the Moskva River that crosses the city of Moscow. ... The advanced reservation by e-mail will be considered first. ... The ticket price is $25 for full participants (who have paid $250-$300), and $50 for the accompanying persons and those who paid reduced fee. ... Registration fee: full ($250-300), reduced, or student, or "no fee" (for the accompanying person.) ...

Еще в разделе: (Показать все результаты (>6) - acs366.phys.msu.su/ )

Site News . ... Archive of Site News . Updating on pages of Laboratory of Avian's Ecology and Behavior Control . ... A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS) ...

Еще в разделе: (Показать все результаты (>2166) - www.sevin.ru/ )

• A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS): News: News: Third
• A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS): News: News: XX
• A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS): News: News:

... Главная -> Фильмы -> You Got Served . ... Фильмы . ... You Got Served . ... США 2004 . ... Chris Stokes . ... Lil' Fizz . ... Jerome Jones . ... Malcolm David Kelley . ... Christopher Jones . ... Irene Stokes . ... Kimberly 'Lil' Kim' Jones . ... David 'Elsewhere' Bernal . ... Aminah Abdul-Jillil . ...

Еще в разделе: (Показать все результаты (>470) - kinfo.ru/ )

• Time Served - Фильмы - Kinfo.ru
• Are You Being Served? - Фильмы - Kinfo.ru
• You Got Served, Take It to t.. - Фильмы - Kinfo.ru