... The normal directory layout consists of a single top-level directory (The default name is /usr/src/redhat ), with five subdirectories. ... Contains the binary package files created by the build process. /usr/src/redhat/SRPMS ? ... ls -lF /usr/src/redhat total 5 drwxr-xr-x 3 root root 1024 Aug 5 13:12 BUILD/ drwxr-xr-x 3 root root 1024 Jul 17 17:51 RPMS/ drwxr-xr-x 4 root root 1024 Aug 4 22:31 SOURCES/ drwxr-xr-x 2 root root 1024 Aug 5 13:12 SPECS/ drwxr-xr-x 2 root root 1024 Aug 4 22:28 SRPMS/ # . ...

Еще в разделе: (Показать все результаты (>757) - uneex.lorien.cs.msu.su/ )

• RECEIVED
• mod_example - Apache HTTP Server
• YIELDDISC

... Consider the Virtual Brewery, a small company that brews, as the name indicates, virtual beer. To manage their business more efficiently, the virtual brewers want to network their computers, which all happen to be PCs running a bright and shiny 1.0. ... They run an Ethernet of their own. Quite naturally, the two companies want to link their networks once they are operational. As a first step, they want to set up a gateway host that forwards datagrams between the two subnets. ...

Еще в разделе: (Показать все результаты (>443) - itpm.msu.su/ )

• mod_example - Apache HTTP Server
• mod_dav - Apache HTTP Server
• mod_charset_lite - Apache HTTP Server

. This diagram illustrates the boxes generated by a UL list with two LI list items. There are two parts to the illustration. The first shows the actual rendering of the boxes generated by the list elements. Background colors and border styles vary to delimit the box areas. The second shows the same rendering, but the content, padding, border, and margin edges of each box are shown explicitly. In particular, the illustration shows how vertical margins between the LI boxes collapse. Return to image.

Еще в разделе: (Показать все результаты (>1145) - crydee.sai.msu.ru/ )

• Background color examples
• Long description for example showing how structurally overlapping cells are
• A Simple Example With a Single Chirp Component

Next: Using the CG-editor Up: Java Interface Previous: A generic DII interface . ... The sources of the example are located in the directory mico/tools/ir-browser . ... Once the applet has been loaded, click on the button called Start IR browser . ... If you click on one of these icons using the left mouse button, the IDL source code of that object is shown in the left side of the window. ... click on the withdraw icon with the right mouse button in the browser window to invoke the withdraw() method . ...

Еще в разделе: (Показать все результаты (>586) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_example
• Qt Toolkit - layout/layout.cpp example file
• Qt Toolkit - trivial/trivial.cpp example file

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>96) - neptun.sai.msu.ru/ )

... Inter-Communication Examples . ... Therefore, group 0 requires one inter-communicator, group 1 requires two inter-communicators, and group 2 requires 1 inter-communicator. main(int argc, char **argv) { MPI_Comm myComm; /* intra-communicator of local sub-group */ MPI_Comm myFirstComm; /* inter-communicator */ MPI_Comm mySecondComm; /* second inter-communicator (group 1 only) */ int membershipKey; int rank; . ... Build inter-communicators. ... int buffer[10], rank; int local_leader = 0; . ... Центры ....

Еще в разделе: (Показать все результаты (>405) - www.parallel.ru/ )

• Client/Server Examples | PARALLEL.RU - Информационно-аналитический центр по
• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Spawn Example | PARALLEL.RU - Информационно-аналитический центр по параллельным

... destroy a single variable unset ($foo); // destroy a single element of an array unset ($bar['quux']); // destroy more than one variable unset ($foo1, $foo2, $foo3); . The behavior of unset() inside of a function can vary depending on what type of variable you are attempting to destroy. ... The variable in the calling environment will retain the same value as before unset() was called. function destroy_foo() { global $foo; unset($foo); } $foo = 'bar'; destroy_foo(); echo $foo; . ... bar . ...

Еще в разделе: (Показать все результаты (>841) - oit.cmc.msu.ru/ )

• arsort
• fbsql_field_name
• asort

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

Электронная библиотека Попечительского совета . ... Doukhan P. - Mixing. Properties and examples . ... Название: Mixing. ... Автор: Doukhan P. Аннотация: . These notes are devoted to the study of mixing theory. The underlying goal is to provide statisticians dealing with problems involving weak dependence properties, with a powerful and easy tool. ... mixing 3 17 32 45 57 80 . mixing 5 119 . ... Mixing 21 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>7438) - lib.mexmat.ru/ )

• Marchal B. - XML by Example :: Электронная библиотека попечительского совета
• Gupta A., Laliberte S. - Defend I.T.: security by example :: Электронная
• Журнал Probability and Statistics by Example :: Электронная библиотека

... TextFormattingFAQ 4 - 2000-08-18 - PeterThoeny . ... Changed: . A question mark after a word is a link to a not yet existing topic. For example, WinAPI is a valid WikiTopic name in WikiNotation , but the actual topic WinAPI does not exist. ... For example, WinAPI is a valid WikiName , but the actual topic WinAPI does not exist. ... If you do not intend to create a topic for a valid TWiki topic name, you can prevent it being linked by putting an HTML tag in front of it. I usually use <NOP>. ...

Еще в разделе: (Показать все результаты (>39912) - dualopt1.cmm.msu.ru/ )

• IfStatements - TWiki - TWiki - (printable)
• TextFormattingFAQ - TWiki - TWiki

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>18791) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2606.txt.pdf
• http://mirror.msu.net/pub/gentoo-portage/net-dns/ez-ipupdate/files/ez-ipupdate-3.0.11.13.3_beta8-dnsexit.diff
• http://mirror.msu.net/pub/gentoo-portage/net-dns/ez-ipupdate/files/ez-ipupdate-3.0.11.13.3_beta8-3322.diff

Hide Zen home . ... Index . ... Also, it supports full index scan. ... Prefix search: words=# select count(*) from words where w1 like 'a%'; count ------- 15491 (1 row) Time: 7.502 ms words=# select count(*) from words where w2 like 'a%'; count ------- 15491 (1 row) Time: 31.152 ms . Wildcard search: words=# select count(*) from words where w1 like '%asd%'; count ------- 26 (1 row) Time: 147.308 ms words=# select count(*) from words where w2 like '%asd%'; count ------- 26 (1 row) Time: 0.339 ms . ...

Еще в разделе: (Показать все результаты (>1840) - www.sai.msu.su/ )

• Open Source Convention
• The Name of the Plug-In: Example Images
• GIMP Plug-In Examples

High Noon Analemma Over Azerbaijan . ... Credit Copyright: Tun Tezel ( TWAN ) Explanation: Is the Sun always straight up at noontime? ... For example, the Sun never appears directly overhead from locations well north or south of the Earth's equator. Conversely, there is always a place on Earth where the Sun will appear at zenith at noon -- for example on the equator during an equinox . ... NASA Web Site Statements, Warnings, and Disclaimers . NASA Official: Jay Norris. ...

Еще в разделе: (Показать все результаты (>4273) - www.astronet.ru/ )

• Find the Man in the Moon
• Астронет > Haute Provence Star Trails
• Haute Provence Star Trails

Alignment DNA issues are still actual in modern genetics. Known algorithms (for example, heuristic algorithm used by BLAST software, Needleman­Wunsch algorithm) are provide solution, but possible are not completely optimal by speed, computational resources or don't provide fullness search (needed accuracy) for solution finding. ... In this paper a method that can ensure absolute accuracy, is presented. ... Known methods of alignments are discussed and demonstrated. ...

Еще в разделе: (Показать все результаты (>82) - mccmb.belozersky.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>51) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>5) - storage.bioinf.fbb.msu.ru/ )

To print commands and their arguments as they are executed: cat example #!/bin/sh TEST1=result1 TEST2=result2 if [ $TEST1 = "result2" ] then echo $TEST1 fi if [ $TEST1 = "result1" ] then echo $TEST1 fi if [ $test3 = "whosit" ] then echo fail here cos it's wrong fi . This is a script called example which has an error in it; the variable $test3 is not set so the 3rd and last test [ command will fail. Running the script produces: example result1 [: argument expected . ...

Еще в разделе: (Показать все результаты (>473) - comet.sai.msu.ru/ )

• Example of how mail is displayed
• Examples of using the diff command
• Examples of using the sort command

We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>729) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples

... О UNИX . ... Examples . ... 1 s = raw_input () 2 repeat = 0 3 for i in xrange ( 1 , len ( s )+ 1 ): 4 found = 1 5 for k in xrange ( 1 , len ( s )/ i ): 6 equal = 0 7 for j in xrange ( i ): 8 if s [ j ]== s [ j + i * k ]: 9 equal += 1 10 if equal == i : 11 found += 1 12 if found * i == len ( s ): 13 if repeat < found : 14 repeat = found 15 print repeat . ... LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples (последним исправлял пользователь PavelSutyrin 2014-11-05 12:16:59) . ...

Еще в разделе: (Показать все результаты (>158) - uneex.mithril.cs.msu.su/ )

• Index of /static/GimpDoc_EnRu/images/dialogs/examples
• Index of /static/GimpDoc_EnRu/images/filters/examples
• HelpOnMoinCommand/ExportDump - UNИX