... 2002 June 20 . Bright Galaxy M81 . ... Explanation: Big and beautiful spiral galaxy M81 , in the northern constellation Ursa Major , is one of the brightest galaxies visible in the skies of planet Earth. This superbly detailed view reveals its bright nucleus, grand spiral arms and sweeping cosmic dust lanes with a scale comparable to the Milky Way . ... The errant dust lane may be the lingering result of a close encounter between M81 and its smaller companion galaxy, M82 . ... About APOD | ...

Еще в разделе: (Показать все результаты (>9832) - www.sai.msu.su/ )

• Astronomy Picture of the Day
• APOD: 2010 March 16 - Detailed View of a Solar Eclipse Corona
• APOD: July 16, 1995 - The Exploration of Mars

... December 8, 1996 . Degas Ray Crater on Mercury . ... Explanation : Like the Earth's Moon, Mercury is scarred with craters, testifying to an intense bombardment during the early history of the Solar System. ... In the above mosaic the bright rays emanating from the 27 mile wide Degas crater almost appear to be painted on . The rays consist of light colored material blasted out during the crater's formation. Numerous smaller, younger craters are seen superposed on the Degas crater itself. ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 June 21 - Solstice Celebration
• APOD: November 12, 1996 - Comet Hale-Bopp Passes M14
• APOD: 2000 December 20 - Sgr A: Fast Stars Near the Galactic Center

... Four Faces of Mars . ... WFPC2 , HST , NASA Explanation: As Mars rotates, most of its surface becomes visible. ... Dark and light sand and gravel create an unusual blotted appearance for the red planet . Winds cause sand-tinted features on the Martian surface to shift over time. ... Publications with keywords: Mars - surface - sand . Publications with words: Mars - surface - sand . ... Victoria Crater on Mars . ... Inside Victoria Crater on Mars . A Path Into Victoria Crater on Mars . ...

Еще в разделе: (Показать все результаты (>75649) - www.astronet.ru/ )

• Астронет > Four Faces of Mars
• Journal "Peremennye Zvezdy"
• Huygens Discovers Luna Saturni

. Научная Библиотека . Отдел Обслуживания Физического Факультета МГУ . A B C D E F G H I J K L M N O P Q R S T U V W X Y Z . (495) 939-16-96, 939-42-04 . Copyright ї 2004 mailto:lib@phys.msu.su . Научная Библиотека Физического факультета МГУ имени М. В. Ломоносова . Разработано EA Studio .

Еще в разделе: (Показать все результаты (>8) - wwwlib.phys.msu.ru/ )

The QPicture class is a paint device that records and replays QPainter commands. ... bool  isNull  () const . uint  size  () const . const char*  data  () const . ... Example of how to record a picture: QPicture pic; QPainter p; p. begin ( &pic ); // paint in picture p. drawEllipse ( 10,20, 80,70 ); // draw an ellipse p. end (); // painting done pic. save ( "drawing.pic" ); // save picture . ... Returns a pointer to the picture data. ... Returns the size of the picture data. ...

Еще в разделе: (Показать все результаты (>598) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QBrush Class
• Qt Toolkit - QPoint Class
• Qt Toolkit - picture/picture.cpp example file

Use of humates to remediate polluted environments: . ... Picture gallery of the events . ... Use of different adsorbents (peats, sapropels, ceolites) in remediation technologies . ... Bezuglova, O.S. Use of humates and humate-enzyme complexes for the detoxification of soils contaminated with heavy metals. ... Coffee break . 11:00-12:00 . ... Theory and practice of humates use for remediation of polluted environments . ... Round table discussion: Working groups . ...

Еще в разделе: (Показать все результаты (>140) - mgumus.chem.msu.ru/ )

• Picture gallery of the participants and guests

... More detailed control . Up: Linking and running programs Next: Special features of different systems Previous: Running with mpirun . For more control over the process of compiling and linking programs for mpich , you should use a Makefile . ... To do this, start with the file Makefile.in in /usr/local/mpi/examples . Modify this Makefile.in for your program and then enter . mpireconfig Makefile (not mpireconfig Makefile.in ). This creates a Makefile from Makefile.in . ... Центры . ...

Еще в разделе: (Показать все результаты (>470) - www.parallel.ru/ )

• Special features of different systems | PARALLEL.RU -

.

Еще в разделе: (Показать все результаты (>5175) - crydee.sai.msu.ru/ )

• RELATED WORK
• "Can You Picture That"
• Moving Pictures Songlist

Next: Observational Zoo of Binaries Up: No Title Previous: Contents . In the early 1980s, our understanding of binary star evolution љ based on the pioneer work by Paczynski (1971)[ 150 ], Tutukov and Yungelson (1973)[ 195 ], van den Heuvel and Heise (1972)[ 201 ], allowed us to construct a general evolutionary scenario љ which successfully explained the genesis of well-studied normal stars and offered potential explanation for new X-ray sources discovered in space experiments. ...

Еще в разделе: (Показать все результаты (>454) - xray.sai.msu.ru/ )

• Simple Universe
• Tsiolkovskii's Paradox
• Scientific News

... Ballew J., Slack S.E. - Breakthrough Windows VistaT: Find Your Favorite Features and Discover the Possibilities . ... Название: Breakthrough Windows VistaT: Find Your Favorite Features and Discover the Possibilities . Авторы: Ballew J., Slack S.E. Аннотация: . ... You can jump right in to any topic that interests youand discover the possibilities of what you can do with Windows Vista! ... advanced printing features . ... AutoMovie feature . ... autoplaylist of favorite songs . ... features . ...

Еще в разделе: (Показать все результаты (>14212) - lib.mexmat.ru/ )

• Tuxworth N. - Clothes: A Very First Picture Book :: Электронная библиотека
• Nemoodar S., Sandy J. - Orthodontics: Picture Test Atlas :: Электронная
• Поиск книг, содержащих picture (окружение) :: Электронная библиотека

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>137) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• TreeTop - Phylogenetic Tree prediction

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: give the motion picture to the a great de . ... Within the summertime time, the cheap oakley m frame sunglasses have improve to get the needed stylish parts,such as low-cost Oakley sun shades which make world's enormous vogue.It truly is genuinely so wonderful to decorate during the Most recent layout oakley sun shades to become the top quantity one fashion item. ...

Еще в разделе: (Показать все результаты (>7214) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Ideas To outlet Track down The
• Экологический Форум - Фундаментальная Экология: give the motion picture to a
• Экологический Форум - Фундаментальная Экология: provide the motion picture to

Acanthodoris pilosa : drawing and photo . ... Asterias rubens : drawing , photo of whole animal and of one ray , bipinnaria . ... Buccinum undatum : drawing: shell and general view , one more general view and photo . ... Cyanea arctica . ... Hemythiris pisttacea : photo and drawing: post-mortem and general view . ... Mytilus edulus : drawing: general view and post mortem and photo . ... Semibalanus balanoides : drawing: general view ( closed and opened ), limbs and photos: detailed and general view . ...

Еще в разделе: (Показать все результаты (>221) - herba.msu.ru/ )

• Living Pictures

DVM debugger - contents . Part 1 (1 - 4) . ... Writing to read-only variable is detected. ... Using non-initialized element <elem> . ... Using variable <var> before asynchronous reduction competed . ... The dynamic debugger detects access to a shadow element before asynchronous shadow renew competed . ... It is reported when any non-correspondence of trace or loop description file is detected. ... Different values of reduction operation are detected for current event and in reference trace record. ...

Еще в разделе: (Показать все результаты (>108) - sp.cs.msu.ru/ )

• Lib-DVM. Detailed design
• DVM debugger. Detailed design
• Fortran DVM compiler. Detailed design

Supernova 2009js in NGC 918 . This page is devoted to information on Supernova 2009js in NGC 918 . Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the updates and links web pages. Discovered independently by Lick Observatory Supernova Search (USA) and Koichi Itagaki (Japan). ... 2009/10/11.44 . 17.2 . ... Joseph Brimacombe . ...

Еще в разделе: (Показать все результаты (>340) - www.rochesterastronomy.org/ )

• Supernova 1998ey in NGC 7080

... Astronomy search engine . ... PhysicsWeb Home Page . ... Sternberg Astronomical Institute . ... Astro Space Center Home Page . ... Landau Institute for Theoretical Physics . ... Astronomy and Space Physics Dept of Kiev University . ... NATIONAL RADIO ASTRONOMY OBSERVATORY Home Page . University of Hawaii - Institute for Astronomy . ... Space Telescope Science Institute Home Page . ... Sky & Telescope: The Essential Magazine of Astronomy . ... Springer LINK - Physics Online Library . ... Home . ...

Еще в разделе: (Показать все результаты (>200) - astro.uni-altai.ru/ )

. To see a Russian version of this page, click here . (Professor, Director of SAI. Graduated from the Moscow State University (MSU) in 1964, Ph.D. 1967, MSU, Dr. of Science 1975, MSU) . A member of IAU and EAS, IAU committees No 42, 27. Fields of interest: Stellar astrophysics, close binary systems, inverse problems in astrophysics. Send your mail to: cher@sai.msu.su .

Еще в разделе: (Показать все результаты (>11) - uranus.sai.msu.ru/ )

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>95) - neptun.sai.msu.ru/ )

... PhD in Physics . Research associate . at chair of polimers . Faculty of Physics of Moscow State University . ... biophysics chair of . ... Scanning Probe Microscopy joint research group . this page was visited times ...

Еще в разделе: (Показать все результаты (>105) - www.spm.genebee.msu.ru/ )

• Image formation and processing methods
• Surface highlighting
• Videocameras

How to order pictures . The works of our photographers are available for purchase in Books, Posters, Calendars, and as a digital pictures on CD. Click on any of the following sections and choose from a variety of high quality EcoPhoto products. Books . Fine Prints/Posters . Calendars . ... Placing an order is easy. Orders can be made via e-mail, or post. Acceptable forms of payment are cash, money order, and personal check. ... Moscow State University Science Park, . ...

Еще в разделе: (Показать все результаты (>245) - www.fadr.msu.ru/ )

• Фотоархив "EcoPhoto" - Order images - Calendars