... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. 2014 October 25 . Sunspots and Solar Eclipse . ... Explanation: A New Moon joined giant sunspot group AR 2192 to dim the bright solar disk during Thursday's much anticipated partial solar eclipse. ... But the timing of solar eclipses is easier to predict. ... About APOD | ... NASA Official: Phillip Newman Specific rights apply . ...

Еще в разделе: (Показать все результаты (>9099) - www.sai.msu.su/ )

• APOD: 2000 October 13 - Eclipse Moon Trail
• APOD: 2005 October 7 - Eclipse Madrid
• APOD: 2014 October 11 - Eclipse at Moonrise

Astronomy Picture of the Day . La Palma Eclipse Sequence . ... Credit Copyright: Miguel Claro ( TWAN ) Explanation: At left, a dramatic image sequence follows late September's total lunar eclipse above a rugged landscape and sea of clouds from the Canary island of La Palma . Composited in a circular fisheye projection, the brightness of the Full Perigee Moon changes drastically in transition from outside the total eclipse phase compared to its dim glow during the 72 minute long totality . ...

Еще в разделе: (Показать все результаты (>74900) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Annular Eclipse Over Myanmar

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. 2000 November 8 . October Skylights . ... Explanation: With brilliant Venus above the western horizon at sunset and Jupiter and Saturn high in the east by early evening, November's night sky is filled with bright planets. October's sky featured bright planets as well and, triggered by the active Sun, some lovely auroral displays . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: October 16, 1995 - Starburst Galaxy M94
• APOD: October 18, 1999 - NGC 3603: An Active Star Cluster
• APOD: October 2, 1999 - Phi Persei: Double Star

Supernova 2009js in NGC 918 . This page is devoted to information on Supernova 2009js in NGC 918 . Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the updates and links web pages. Discovered independently by Lick Observatory Supernova Search (USA) and Koichi Itagaki (Japan). ... 2009/10/11.44 . 17.2 . ... Joseph Brimacombe . ...

Еще в разделе: (Показать все результаты (>471) - www.rochesterastronomy.org/ )

... Photos . Rainbow in Cambridge . ... Different phases of the lunar eclipse . ... Копосов Сергей , 2003-2007 . Koposov Sergey , 2007 ...

Еще в разделе: (Показать все результаты (>309) - lnfm1.sai.msu.ru/ )

• Photos from the ADASS conference and the trip to Spain and Portugal
• Shugarov's Home Page
• IDL programs

SVETKA, a program for analysis of different alignments . Back to the help page . ... Such a feature can look like " Leucine in the position 362 of the alignment of the entire family " and can, in many cases, be a "decision rule" to distinguish sequences from two sides of a tree branch. ... Comparing the alignment with an input tree (the tree may be entered by the user or reconstructed with the WPGMA algorithm), the program detects supporting positions of the alignment for every branch the tree. ...

Еще в разделе: (Показать все результаты (>1245) - monkey.belozersky.msu.ru/ )

• SDP home page
• About COGs

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>186) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for processing video with flicker effect (fast and abrupt frame brightness changes). ... The graph for MSU Deflicker filter has same smoothness as graph of D.Graft's filter, but MSU Deflicker filter better corresponds to global brightness change along the movie. Now let's consider work of the filter in case of frame brightness jump. ...

Еще в разделе: (Показать все результаты (>243) - graphics.cs.msu.ru/ )

• Removing of brightness flicker in video | Лаборатория компьютерной графики и
• MSU Video Codec Comparison | Graphics and Media Lab
• MSU Video Codec Comparison | Лаборатория компьютерной графики и мультимедиа

... During the three days of conference, 30 oral and 11 poster papers were presented about: i) Paleosol-sedimentary sequences (loess, alluvial, lacustrine, volcanic, etc.) as a record of the Pleistocene and Holocene environmental change; ii) Magnetic properties of Quaternary and pre-Quaternary paleosols and sediments as paleoclimatic indicators; iii) Paleopedology and archaeology and dating of paleosols. Paleopedological evidences of ancient man-induced environmental change. Applied Paleopedology. ...

Еще в разделе: (Показать все результаты (>168) - www.fadr.msu.ru/ )

... Levitskaya O., Glazko V.I. Centre of experimental embryology and reproductive biotechnology Russian Academy of Agricultural Sciences e-mail: sotnikova.evgeniya@gmail.com For a comparative analysis of the prevalence of nucleotide substitutions in different genes of the proviral DNA of bovine leukemia virus in our studies performed comparing the frequency nucleotide substitutions and nonsynonymous to synonymous substitutions ratio (Kn/s) in the coding sequences of genes env and pol. ...

Еще в разделе: (Показать все результаты (>305) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/17.pdf

... October 8, 15:00 15:40 . ... PDF [7.2б MB] October 8, 15:40 16:10 . ... The sky brightness, atmospheric extinction, cloud coverage and auroral appearance are obtained from these images. ... Aurorae are identified by comparing the observed sky brightness to the sky brightness expected from this model. ... The identification of few potential sites for future's larger facility require several instruments, measuring various site characterizing parameters. ...

Еще в разделе: (Показать все результаты (>223) - site2010.sai.msu.ru/ )

• General information
• Results of recent and ongoing site programs
• Methods and instruments to measure/monitor major site properties

... The Second International Astronomy Olympiad . ... Problems to solve, 8-10 Form Text of these problems is available in Russian too. ... Two stars have the same absolute magnitude. ... The orbital period of Mars is 687 days. ... See problem 2. for 8-10 Form. ... Problem to solve, 9-12 Form Text of the problem is available in Russian too. ... Problem is about Doppler-effect, to find velosities of two stars using their spectra and spectrum of our Sun, to estimate speed of the Earth moving around the Sun...

Еще в разделе: (Показать все результаты (>16) - www.issp.ac.ru/ )

• The International Olympiad of Euro-Asian Astronomical Society

... MPI_Comm_compare . ... All MPI routines in Fortran (except for MPI_WTIME and MPI_WTICK ) have an additional argument ierr at the end of the argument list. ierr is an integer and has the same meaning as the return value of the routine in C. In Fortran, MPI routines are subroutines, and are invoked with the call statement. ... All MPI routines (except MPI_Wtime and MPI_Wtick ) return an error value; C routines as the value of the function and Fortran routines in the last argument. ... Центры . ...

Еще в разделе: (Показать все результаты (>319) - www.parallel.ru/ )

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>32) - observ.pereplet.ru/ )

... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Compare Shopping . ... Emme from Kansas City ALL O <a href=http://noapaa42.blog.com/>more information</a> others to make a decision . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . Вы не можете публиковать новые темы в этом форуме . ...

Еще в разделе: (Показать все результаты (>4224) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: of also of rare, For October
• Экологический Форум - Фундаментальная Экология: tax of goods compared that
• Экологический Форум - Фундаментальная Экология: industry refers sales compared

Russian abstract] . Russian full text] . The classifications revealed by geometric morphometry and classical morphometry for Drosera rotundifolia , D. obovata , D. anglica and D. linearis were compared. ... the form of petiole middle part transverse section is the effective distinguishing character for the some different species and inter-species hybrids of Drosera ; . the consensus configurations are preferable for the geometric morphometry analysis of populations. ...

Еще в разделе: (Показать все результаты (>601) - herba.msu.ru/ )

• The behavior of Nymphaea flowers
• UI Botanical Garden, Moscow, October 7, 2006

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6962) - mouse.belozersky.msu.ru/ )

... In order to compare the number of different evolutionary stages obtained and X-ray luminosity of the chosen X-ray sources with the observed galactic values we use the sum of C/O+O/C , where C and O are the calculated and observed values of a given binary type, respectively. If we make comparison for a number of different binary species (for example, we compare the number of CV, number of X-ray pulsars,   total X-ray luminosity of LMXB, etc.), we write this criterion in the form: . ...

Еще в разделе: (Показать все результаты (>501) - xray.sai.msu.ru/ )

• Nomenclature
• Seminars
• Basic Observational Data for Determination of f(q) and

Электронная библиотека Попечительского совета . ... Hartle T. - Comparing Indicators: Stochastics %K versus Williams' %R . ... Название: Comparing Indicators: Stochastics %K versus Williams' %R . Автор: Hartle T. Аннотация: . ... An example of this situation is the application of the stochastics indicator (%K) and Williams' %R. Both indicators are overbought/oversold oscillators. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>11005) - lib.mexmat.ru/ )

• Clayberg E., Rubel D. - Eclipse: Building Commercial-Quality Plug-ins ::
• Carstensen B. - Comparing and predicting between several methods of measurement
• Garola C. (ed.), Rossi A. (ed.), Sozzo S. (ed) - The foundations of quantum

... An hour later, the satellite has proceeded to higher altitudes and the auroral proton precipitation pattern can be seen, using the SI-12 proton imager. ... The IMF dependence of the proton cusp signature has been described at length recently in several papers by Frey et al. [2002, 2003]. movie of this event This is just the first indication of activity and this storm is a continuing event, now with (a possibly unprecedented) 2 successive dips of DST below -300 nT. ... Proton aurora in the cusp . ...

Еще в разделе: (Показать все результаты (>99) - www.kosmofizika.ru/ )

• Top Story - X 17.1 Flare Observed - October 28, 2003
• Science Technology: Ongoing Solar Activity
• CREATION AND DESTRUCTION OF THE SOLAR PROTON BELTS IN THE INNER MAGNETOSPHERE