... 2006 June 3 . Gamma-Ray Earth . ... The Earth's gamma-ray glow is indeed very faint, and this image was constructed by combining data from seven years of exposure during the life of the Compton Gamma Ray Observatory , operating in Earth orbit from 1991 to 2000. ... Astronomers need to understand Earth's gamma-ray glow well as it can interfere with observations of cosmic gamma-ray sources like pulsars, supernova remnants , and distant active galaxies powered by supermassive black holes . ...

Еще в разделе: (Показать все результаты (>3066) - www.sai.msu.su/ )

• APOD: 2005 March 31 - Gamma Ray Earth
• APOD: 2005 April 5 - Light from a Distant Planet
• APOD: 2006 June 24 - Nix and Hydra

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. 2000 July 26 . Lingering Lunar Eclipse . Credit Copyright: Noel Munford (Palmerston North Astronomical Society, New Zealand) . Explanation: As the Moon passed almost directly through the center of Earth's shadow on July 16th, sky gazers in the Pacific hemisphere were graced by a lingering lunar eclipse . ... About APOD | ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: April 2, 1999 - Stars of NGC 206
• APOD: 2000 December 15 - IC443's Neutron Star
• APOD: October 4, 1995 - The Sun Spews X-rays

... Credit: Greg Bacon ( STScI ), NASA Explanation: The last decade saw the profound discovery of many worlds beyond our solar system, but none analogs of our home planet Earth . Exploiting precise observational techniques, astronomers inferred the presence of well over two dozen extrasolar planets , most nearly as massive as gas giant Jupiter or more, in close orbits around sun-like stars. ... Publications with keywords: extrasolar planet - planet - Saturn - planetary system . ... Crescent Saturn . ...

Еще в разделе: (Показать все результаты (>74484) - www.astronet.ru/ )

• Астронет > Saturn-Sized Worlds Discovered
• Henrietta Leavitt Calibrates the Stars
• Астронет > Henrietta Leavitt Calibrates the Stars

... MPI_Comm_compare . ... All MPI routines in Fortran (except for MPI_WTIME and MPI_WTICK ) have an additional argument ierr at the end of the argument list. ierr is an integer and has the same meaning as the return value of the routine in C. In Fortran, MPI routines are subroutines, and are invoked with the call statement. ... All MPI routines (except MPI_Wtime and MPI_Wtick ) return an error value; C routines as the value of the function and Fortran routines in the last argument. ... Центры . ...

Еще в разделе: (Показать все результаты (>390) - www.parallel.ru/ )

Электронная библиотека Попечительского совета . ... Hartle T. - Comparing Indicators: Stochastics %K versus Williams' %R . ... Название: Comparing Indicators: Stochastics %K versus Williams' %R . Автор: Hartle T. Аннотация: . ... An example of this situation is the application of the stochastics indicator (%K) and Williams' %R. Both indicators are overbought/oversold oscillators. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10768) - lib.mexmat.ru/ )

• Carstensen B. - Comparing and predicting between several methods of measurement

Supernova 2009js in NGC 918 . This page is devoted to information on Supernova 2009js in NGC 918 . Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the updates and links web pages. Discovered independently by Lick Observatory Supernova Search (USA) and Koichi Itagaki (Japan). ... 2009/10/11.44 . 17.2 . ... Joseph Brimacombe . ...

Еще в разделе: (Показать все результаты (>336) - www.rochesterastronomy.org/ )

• Supernova 2002cr and 2002ed in NGC 5468

Russian abstract] . Russian full text] . The classifications revealed by geometric morphometry and classical morphometry for Drosera rotundifolia , D. obovata , D. anglica and D. linearis were compared. ... the form of petiole middle part transverse section is the effective distinguishing character for the some different species and inter-species hybrids of Drosera ; . the consensus configurations are preferable for the geometric morphometry analysis of populations. ...

Еще в разделе: (Показать все результаты (>185) - herba.msu.ru/ )

• The behavior of Nymphaea flowers

... Ivanovo State University . My experience as a Fulbright scholar in the USA gave me an ample opportunity to compare the structure, functions and modes of self-identification in the US and Russian academic communities. Overall, the American university system seemed more flexible and capable of self-adjusting to the demands of the moment. ... Though Russia is far behind the USA in technology and electronic media, we still can adopt some American educational technologies. ...

Еще в разделе: (Показать все результаты (>103) - www.prof.msu.ru/ )

Diploma thesis abstract Dmitry V. Khakhulin Scientific Advisor Dr. Roman V. Volkov Defense date: December 22, 2006 Efficient Conversion of Subterawatt Radiation of Ti:Sapphire Laser System into Wavelength Range 300­400 nm. ... The first, direct supercontinuum generation in fused silica and LiF under the influence of second harmonic radiation of Ti:Sapphire laser system. ... Subsequent generation of second harmonic from amplified supercontinuum radiation carried out in 1 mm thickness BBO crystal. ...

Еще в разделе: (Показать все результаты (>191) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2008/Kulikov_Shmalhausen_en.pdf

... During Later Cenozoic within Central Asia the series of independently evolving volcanic areas (so-called Central Asian Volcanic Province (CAVP)) has formed [1]. They are Udokan (UVA), Vitim (VVA), Southern Baycalian (SBVA) and Khangai (KVA) volcanic areas. ... Geophysical studies of CAVP [2] revealed presence of large-scale ledge of an asthenospheric mantle (or hot field of mantle) with roof elevated on 100 km to surface. ... End-member component of the basalts from UVA is a weak depleted mantle. ...

Еще в разделе: (Показать все результаты (>553) - geo.web.ru/ )

How do Linux Threads compare with other OSs'? ... Solaris . ... Priority Scheduling [1] . ... Mutex Attributes . ... Thread Attributes . ... Posix and Solaris link thread priorities with mutexes and use the priority of a blocked thread's mutex to alter the priority of the blocking thread. Win32 and Linux let the scheduler determine what thread to elevate in priority. ... Solaris implements it because they need it: the program can change certain thread's attributes unless it is suspended. ...

Еще в разделе: (Показать все результаты (>505) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_alias
• Apache module mod_setenvif
• Apache module mod_access

... While RPM's build root requires a certain amount of spec file and make file tweaking in order to get it working properly, directing RPM to perform the build in a different directory is a snap. ... RPM's build area consists of five directories in the top-level: . ... The next step in getting RPM to use a different build area is telling RPM where the new build area is. ... exit 0 Executing: %build + cd /home/ed/mybuild/BUILD + cd cdplayer-1.0 + make gcc -Wall -O2 -c -I/usr/include/ncurses cdp.c ? ...

Еще в разделе: (Показать все результаты (>384) - uneex.lorien.cs.msu.su/ )

• perchild - Apache HTTP Server
• The Lone Directive: %package
• Comparing Linux/UNIX Binary Package Formats

PHP Manual . ... The switch statement is similar to a series of IF statements on the same expression. ... if ($i == 0) { print "i equals 0"; } if ($i == 1) { print "i equals 1"; } if ($i == 2) { print "i equals 2"; } switch ($i) { case 0: print "i equals 0"; break; case 1: print "i equals 1"; break; case 2: print "i equals 2"; break; } . ... Only when a case statement is found with a value that matches the value of the switch expression does PHP begin to execute the statements. ...

Еще в разделе: (Показать все результаты (>433) - oit.cmc.msu.ru/ )

• ldap_compare
• version_compare
• mcal_date_compare

... Steganography can be used to store the data used in the image file (options /E and /X) Proposed directory for placement: /pub/os2/apps/graphics Your name: A. Doff Email address: m1@uni-one.nl Program contact name: (same) Program contact email: (same) Program URL: http://home.uni-one.nl/m1 Would you like the contact email address included in listings? no Operating System/Version: OS/2 Additional requirements: Replaces: /pub/os2/apps/graphics/belvoir13.zip ...

Еще в разделе: (Показать все результаты (>3304) - crydee.sai.msu.ru/ )

• Tutorial on Fortran 90, Digital UNIX
• Image: Nijo castle, Shogun palace. The main building. Comparing to temples and
• Notables in the transition from Fortran 77 to Fortran 90

... The documentation of NatSkin is crap. ... It does not work (on my TWiki/Cairo installation). ... Why is the sidebar switched off during edit? ... Why are the topic actions named differently compared to standard TWiki? Does NatSkin support QuietSave? ... NatSkin once supported TWiki-2 (Beijing), TWiki-3 (Cairo) and TWiki-4 (Dakar) but has dropped support for Beijing and Cairo since version 3.0. ... Most probably you clicked on "Save" which saved your changes but keept you in the edit process. ...

Еще в разделе: (Показать все результаты (>34592) - dualopt1.cmm.msu.ru/ )

• NatSkinTemplates - TWiki - TWiki
• NatSkinTemplates - TWiki - TWiki - (printable)
• %TOPICTITLE% (8 vs. 9) - TWiki

... Levels of fatty acid binding protein before and after direct current cardioversion of atrial fibrillation or flutter in patients without acute coronary syndrome]. ... CONCLUSION: Unexpectedly most pts with AF and atrial flutter had elevated FABP at baseline. ... AF, atrial flutter and DCC for these arrhythmias should be considered as sources of false positive results when FABP is used for diagnosis of acute myocardial infarction. ...

Еще в разделе: (Показать все результаты (>115) - biochem.bio.msu.ru/ )

• Measurement of B-type natriuretic peptide by two assays utilizing antibodies
• Biochemistry Department of Moscow State University | Regulation of muscle
• Spectral and kinetic parameters of phosphorescence of triplet chlorophyll a in

... Apache HTTP Server Version 2.0 . ... A single control process launches the number of child processes indicated by the NumServers directive at server startup. ... For each child process, Apache assesses the number of idle threads and creates or destroys threads to keep this number within the boundaries specified by MinSpareThreads and MaxSpareThreads . ... The User and Group directives are used to set the privileges of the Apache child processes. ... Maximum number of threads per child process . ...

Еще в разделе: (Показать все результаты (>434) - itpm.msu.su/ )

• mod_ldap - Apache HTTP Server
• mod_setenvif - Apache HTTP Server
• mod_file_cache - Apache HTTP Server

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>148) - www.genebee.msu.ru/ )

• BioSystems, 30 (1993) 57-63 57
• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services

... In recent years among methods for analysis of a genomic data, more interest is attracted to alignment-free methods for comparing samples based on work with k-mers (oligonucleotides of length k, also called l-tuples or n-grams) directly from metagenomic reads. ... 2012) A metagenome-wide association study of gut microbiota in type 2 diabetes, Nature, 7418: 55­60. ... 2010) A human gut microbial gene catalogue established by metagenomic sequencing, Nature, 7285: 59-65. ...

Еще в разделе: (Показать все результаты (>285) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/50.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/138.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/214.pdf

. You can compare any two versions of a file that is under the control of SCCS with the sccsdiff command: /usr/sccs/sccsdiff -r version -r version s. filename . Using this command produces a line by line difference between the two versions of the file. Results are shown in the same format as that produced by the diff command. Examples .

Еще в разделе: (Показать все результаты (>184) - comet.sai.msu.ru/ )

• Comparing directories
• Comparing files
• Examples of comparing files with the sccsdiff command