... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. 2008 June 3 . The Dark River to Antares . ... Explanation: Connecting the Pipe Nebula to the bright star Antares is a flowing dark cloud nicknamed the Dark River . The murkiness of the Dark River is caused by absorption of background starlight by dust , although the nebula contains mostly hydrogen and molecular gas. ... About APOD | ...

Еще в разделе: (Показать все результаты (>9783) - www.sai.msu.su/ )

• APOD: 2015 February 22 - The Dark River to Antares
• APOD: 2009 July 8 - The Dark River to Antares
• APOD: 2004 July 23 - Saturns Rings in Natural Color

... The Dark River to Antares . ... Credit Copyright: Loke Kun Tan ( StarryScapes ) Explanation: Connecting the Pipe Nebula to the bright star Antares is a flowing dark cloud nicknamed the Dark River . ... Antares , the brightest star in the frame, is embedded in the colorful Rho Ophiuchi nebula clouds. ... Publications with keywords: Dark River - Antares - Pipe Nebula . Publications with words: Dark River - Antares - Pipe Nebula . ... Colorful Clouds Near Rho Ophiuchi . ... Antares and Rho Ophiuchi . ...

Еще в разделе: (Показать все результаты (>74988) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > The Dark River to Antares

... October 18, 1999 . NGC 3603: An Active Star Cluster . ... Explanation: NGC 3603 is home to a massive star cluster, thick dust pillars, and a star about to explode . The central open cluster contains about 2000 bright stars, each of which is much brighter and more massive than our Sun . ... These stars are less massive than our Sun, demonstrating that great numbers of low-mass stars also form in active starburst regions . ... About APOD > . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: May 22, 1996 - Star Cluster in the Rosette Nebula
• APOD: April 9, 1999 - WR 104: Pinwheel Star
• APOD: 2000 April 24 - Reflection Nebula M78

Supernova 2009js in NGC 918 . This page is devoted to information on Supernova 2009js in NGC 918 . Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the updates and links web pages. Discovered independently by Lick Observatory Supernova Search (USA) and Koichi Itagaki (Japan). ... 2009/10/11.44 . 17.2 . ... Joseph Brimacombe . ...

Еще в разделе: (Показать все результаты (>471) - www.rochesterastronomy.org/ )

• Supernova 2002fk in NGC 1309
• Supernova images - Best of

The QPalette class contains color groups for each widget state. ... QPalette  ( const QColor & background )  . QPalette  ( const QColorGroup & normal, const QColorGroup & disabled, const QColorGroup & active )  . ... const QColorGroup&  normal  () const . ... const QColorGroup&  active  () const . ... A palette consists of three color groups: a normal, a disabled and an active color group. ... Constructs a palette that consists of the three color groups normal, disabled and active. ...

Еще в разделе: (Показать все результаты (>716) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QColorGroup Class

This page is a reference for all CSS classes used in PatternSkin . ... Page type classes . ... TWiki specific classes (emitted by the TWiki engine) have the prefix twiki : twikiButton, twikiToc, etcetera. ... All templates that are not the view template have the body class name "patternNoViewPage". ... patternScreen - outer container, used when centering the page (see PatternSkinCssCookbookCenterPage ) . ... Left bar: . ... patternTopBarContents - header art / logo; contains topic WebTopBar . ...

Еще в разделе: (Показать все результаты (>40272) - dualopt1.cmm.msu.ru/ )

• PatternSkinCssCookbook - TWiki - TWiki - (printable)
• PatternSkinCssCookbook - TWiki - TWiki
• PatternSkinCustomization - TWiki - TWiki

... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS preference settings in System.DefaultPreferences or Main.SitePreferences to your new files: * Set FOSWIKI_LAYOUT_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set FOSWIKI_STYLE_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set FOSWIKI_COLORS_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ... The rest of this topic shows examples of small CSS changes. ...

Еще в разделе: (Показать все результаты (>5921) - wiki.cmc.msu.ru/ )

• PatternSkinCss < System < Foswiki

... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS preference settings in System.DefaultPreferences or Main.SitePreferences to your new files: * Set FOSWIKI_LAYOUT_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set FOSWIKI_STYLE_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set FOSWIKI_COLORS_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ... The rest of this topic shows examples of small CSS changes. ...

Еще в разделе: (Показать все результаты (>2218) - wiki.cs.msu.ru/ )

• VarBUTTON < System < Foswiki

... The CompHEP Lagrangian tables do not describe explicitly the color structure of a vertex. ... for three color octets. ... Each vertex containing 4 color particles is split to 2 vertices which are joined by an automatically generated auxiliary field. ... Instead of evaluating this expression and that splitting all vertices independently, one can introduce one color octet auxiliary field and write this Lagrangian term as . ... enable vertex level splitting (only for vertices with 4 color particles). ...

Еще в разделе: (Показать все результаты (>801) - theory.sinp.msu.ru/ )

Chapter€а5.€а Getting images into GIMP . ... Image types . ... Working with Images . ... There are three possible modes: RGB, grayscale, and indexed. ... Because every humanly distinguishable color can be represented as a combination of red, green, and blue, RGB images are full-color. ... Essentially the difference between a grayscale image and an RGB image is the number of тАЬ color channels тАЭ: a grayscale image has one; an RGB image has three. ... A color image in RGB mode with an Alpha channel. ...

Еще в разделе: (Показать все результаты (>516) - uneex.lorien.cs.msu.su/ )

• Different Places an rpmrc File Resides
• Having RPM Use a Different Build Area

background white restrict none set fontsize 6 set fontstroke 0 color label black script dna.def define polar _dna nucleic and (oxygen, nitrogen) define hydrophobic _dna nucleic and carbon define polar _prot ( protein , mse) and (oxygen, nitrogen) define hydrophobic _prot ( protein , mse) and (carbon, sulphur, selenium) echo echo The sets polar _dna, polar _prot, hydrophobic _dna and hydrophobic _prot are defined ...

Еще в разделе: (Показать все результаты (>1911) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/trac/tanchiki/wiki/TracChangeset?format=txt
• TracChangeset тАУ Tanchiki
• Script

... Character data . ... This section of the specification describes the basic data types that may appear as an element's content or an attribute's value. ... The syntax of valid character data in HTML is defined in terms of the SGML concepts of NAME and CDATA. ... Although the STYLE and SCRIPT elements use CDATA for their data model, for these elements, CDATA must be handled differently by user agents. ... The attribute value type "color" ( %Color ) refers to color definitions as specified in [SRGB] . ...

Еще в разделе: (Показать все результаты (>490) - itpm.msu.su/ )

• Overview of the Directory Tree
• Linux Administration Made Easy: Strategies for Keeping a Secure Server

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>139) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>44) - observ.pereplet.ru/ )

... About lab . ... Detection and correction of unnatural purple colors in images of refractive objects taken by digital still camera . ... color calibration , color correction , color management , digital still camera , light dispersion , monochromatic colors , perceptually uniform color spaces , RAW-processing . ... We discovered significant error in color in images produced by a digital still camera used to capture scenes with a special setup of illumination and an object. ...

Еще в разделе: (Показать все результаты (>226) - graphics.cs.msu.ru/ )

• Smart brightness and contrast correction | Graphics and Media Lab
• Estimation of object's integral brightness | Graphics and Media Lab
• Smart brightness and contrast correction | Лаборатория компьютерной графики и

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>600) - monkey.belozersky.msu.ru/ )

• ETS_all_contacts alignment
• About COGs
• ETS numeration assumed

Mindterm Settings This document lists the different configuration options one may set to configure MindTerm. ... Common connection settings protocol Preferred protocol (auto/ssh1/ssh2) server Name of server to connect to port Port on server to connect to real- server Real address of sshd if it is behind a firewall local -bind Default local address to bind to for forwards username Username to login as password Password for normal authentication (only saved if save passwords ...

Еще в разделе: (Показать все результаты (>426) - www.parallel.ru/ )

• Heterogeneous networks and the ch_p4 device | PARALLEL.RU -
• Heterogeneous networks of multicomputers and the ch_nexus device | PARALLEL.RU
• Derived datatypes | PARALLEL.RU - Информационно-аналитический центр по

... Second set contains blast hits of the contig or the chromosome search against protein database, for example, Uniref90. ... Hit color corresponds to reading frame in the contig, color intensity is grteater than intensities of exons. ... Reading frame of five blast hits in the third exon of gene g4 are different than exon's reading frame . Blast hits in gene g3 located on reverse strand do not match reading frames of the 1st and 3rd exons and overlap 1-2 and 2-3 introns . ...

Еще в разделе: (Показать все результаты (>127) - mouse.belozersky.msu.ru/ )

... 3.0.9 - 3.0.18 only, PHP 4 >= 4.0.0) ImagePSText -- To draw a text string over an image using PostScript Type1 fonts . array imagepstext ( int image, string text, int font, int size, int foreground, int background, int x, int y [, int space [, int tightness [, float angle [, int antialias_steps]]]]) . ... Foreground is the color in which the text will be painted. ... Tightness allows you to control the amount of white space between characters. ... Allowed values are 4 and 16. ...

Еще в разделе: (Показать все результаты (>841) - oit.cmc.msu.ru/ )

• CURL, Client URL Library Functions
• ncurses_color_set
• unpack

Terrapin Station ---------------- Inspiration move me brightly like a song with scents and colors hold away despair More than this I will not ask faced with mystery's dark advance statements just seem vain at last Some rise, some fall, some climb to get to Terrapin Counting stars by candelight all are dim but one is bright, The spiral light of Venus rising first and shining best Oh! from the northwest corner of a brand new crescent ...

Еще в разделе: (Показать все результаты (>5223) - crydee.sai.msu.ru/ )

• Property index
• Background color examples
• Colors and backgrounds