... The Great Nebula in Carina . ... Eta Carinae , the most energetic star in the nebula, was one of the brightest stars in the sky in the 1830s, but then faded dramatically. Eta Carinae is the brightest star near the image center, just left of the Keyhole Nebula . While Eta Carinae itself maybe on the verge of a supernova explosion, X-ray images indicate that much of the Great Carina Nebula has been a veritable supernova factory . Tomorrow's picture: open space . ...

Еще в разделе: (Показать все результаты (>9208) - www.sai.msu.su/ )

• APOD: 2002 June 20 - Bright Galaxy M81
• APOD: 2009 September 23 - CoRoT Satellite Discovers Rocky Planet
• APOD: 2009 November 18 - Water Discovered in Moon Shadow

Discover the cosmos! ... December 6, 1999 . M83: The Southern Pinwheel Galaxy from VLT . ... Explanation: M83 is one of the closest and brightest spiral galaxies on the sky. Visible with binoculars in the constellation of Hydra , majestic spiral arms have prompted its nickname as the Southern Pinwheel. Although discovered 250 years ago, only in this century was it appreciated that M83 was not a gas cloud but a barred spiral galaxy much like our own Milky Way Galaxy . ... About APOD > . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 September 21 - XZ Tauri System Ejects Gas Bubble
• APOD: September 9, 1999 - Comet Hale Bopp Over the Superstition Mountains
• APOD: December 25, 1997 - A Hale Bopp Holiday

... Credit: Rob van Gent , Tiemen Cocquyt , and Carl Koppeschaar Explanation: In 1655, three hundred fifty years ago on this date, Dutch astronomer Christiaan Huygens discovered Luna Saturni - now known as Saturn's moon Titan. To celebrate, consider this intriguing picture of his telescope lens, all that remains of the instrument he used , designed and constructed in collaboration with his brother, Constantijn Huygens. ... Huygens used the verse as part of an anagram announcing his discovery. ...

Еще в разделе: (Показать все результаты (>75335) - www.astronet.ru/ )

• Unusual Hollows Discovered on Planet Mercury
• The Andromeda Galaxy in Infrared
• Астронет > APOD

Use of humates to remediate polluted environments: . ... Picture gallery of the events . ... Use of different adsorbents (peats, sapropels, ceolites) in remediation technologies . ... Bezuglova, O.S. Use of humates and humate-enzyme complexes for the detoxification of soils contaminated with heavy metals. ... Coffee break . 11:00-12:00 . ... Theory and practice of humates use for remediation of polluted environments . ... Round table discussion: Working groups . ...

Еще в разделе: (Показать все результаты (>133) - mgumus.chem.msu.ru/ )

• Picture gallery of the participants and guests

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: provide the motion picture to the much fo . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>5936) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: give the motion picture to a
• Экологический Форум - Фундаментальная Экология: give the motion picture to the
• Экологический Форум - Фундаментальная Экология: provide the motion picture into

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>128) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• TreeTop - Phylogenetic Tree prediction

... Astronomy search engine . ... PhysicsWeb Home Page . ... Sternberg Astronomical Institute . ... Astro Space Center Home Page . ... Landau Institute for Theoretical Physics . ... Astronomy and Space Physics Dept of Kiev University . ... NATIONAL RADIO ASTRONOMY OBSERVATORY Home Page . University of Hawaii - Institute for Astronomy . ... Space Telescope Science Institute Home Page . ... Sky & Telescope: The Essential Magazine of Astronomy . ... Springer LINK - Physics Online Library . ... Home . ...

Еще в разделе: (Показать все результаты (>178) - astro.uni-altai.ru/ )

This example shows how to make, store to file, and read a picture as a set of drawing commands. ... This example ** program may be used, distributed and modified without limitation. ** *****************************************************************************/ # include ctype.h # include qapplication.h # include qpainter.h # include qpicture.h # include qpixmap.h # include qwidget.h # include qmessagebox.h # include qfile.h void paintCar( QPainter *p ) // ...

Еще в разделе: (Показать все результаты (>432) - rtm-cs.sinp.msu.ru/ )

• Pictures of Most Widgets
• Qt Toolkit - QPicture Class

Электронная библиотека Попечительского совета . ... Tuxworth N. - Clothes: A Very First Picture Book . ... Название: Clothes: A Very First Picture Book . Автор: Tuxworth N. Аннотация: . Children dress up and try on all different sorts of clothes in the VERY FIRST PICTURE BOOKS series. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>7707) - lib.mexmat.ru/ )

• Nemoodar S., Sandy J. - Orthodontics: Picture Test Atlas :: Электронная
• Walser H., Pedersen J. - 99 Points of Intersection: Examples, Pictures, Proofs
• Ballew J., Slack S.E. - Breakthrough Windows VistaT: Find Your Favorite

Supernova 2009js in NGC 918 . This page is devoted to information on Supernova 2009js in NGC 918 . Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the updates and links web pages. Discovered independently by Lick Observatory Supernova Search (USA) and Koichi Itagaki (Japan). ... 2009/10/11.44 . 17.2 . ... Joseph Brimacombe . ...

Еще в разделе: (Показать все результаты (>342) - www.rochesterastronomy.org/ )

• Supernova 1998ey in NGC 7080

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Methodology of stereoscopic motion picture quality assessment . ... Conference Paper . ... Conference Name . Stereoscopic Displays and Applications XXIV, Proc. of SPIE-IS&T Electronic Imaging, SPIE . ... http://compression.ru/video/vqmt3d/papers/Methodology%20for%20Stereoscopic%20Motion-picture%20Quality%20Assessment.pdf . ...

Еще в разделе: (Показать все результаты (>159) - graphics.cs.msu.ru/ )

• Methodology of stereoscopic motion picture quality assessment | Лаборатория

. To see a Russian version of this page, click here . (Professor, Director of SAI. Graduated from the Moscow State University (MSU) in 1964, Ph.D. 1967, MSU, Dr. of Science 1975, MSU) . A member of IAU and EAS, IAU committees No 42, 27. Fields of interest: Stellar astrophysics, close binary systems, inverse problems in astrophysics. Send your mail to: cher@sai.msu.su .

Еще в разделе: (Показать все результаты (>11) - uranus.sai.msu.ru/ )

Everybody's brother, everybody's lover, I wanna be your lifetime friend. Crazy as a rocket, nothin in my pocket, I keep it at the rainbow's end. I never think of money, I think of milk 'n honey, grinnin like a cheshire cat. I focus on the pleasure, somethin I can treasure, can you picture that? Dr. Teeth : Floyd, Pick a verse!) ... Really nothin to it, anyone can do it, it's easy and we all know how. ... Can you picture that? ... Teeth) . ... You know it's quick and easy to find! ...

Еще в разделе: (Показать все результаты (>4564) - crydee.sai.msu.ru/ )

• Moving Pictures Songlist
• Image: Picture 269
• Image: Picture 005

Dmitriy Mendeleev . ... Dmitry Ivanovich Mendeleev : A project of undergraduate students from School No.470 (St.Petersburg) . ... Brokhaus Online: Biography of Mendeleev in Russian . ... Original Periodic Table by Mendeleev . ... Mendeleev's "Principles of Chemistry" (4 Pts. in 2 Vols) . ... Mendeleev's house museum in the village Boblovo, Moscow region (in Russian) . Statue of Mendeleev in front of Chemistry Department at Moscow State University (from the article about Russian chemistry in Chem. ...

Еще в разделе: (Показать все результаты (>96) - www.chem.msu.ru/ )

• Immortals of science: Mendeleev

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>73) - neptun.sai.msu.ru/ )

. The HTMLPAGE uses the client-side imagemap construction.Click the any picture to see full-size and full-color images. If your client don't support client-side imagemap, You can append the filename (under each image) to the URL location Description: . Not available yet ... Best Regards, Pavel Plechov

Еще в разделе: (Показать все результаты (>800) - geo.web.ru/ )

• Index of Kamchatka Pictures
• dscn1156.jpg
• dscn0293.jpg

... Adiantaceae . ... Aceraceae . Actinidiaceae . ... Asteraceae ( Compositae , nom. alt.) ... Brassicaceae ( Cruciferae , nom. alt.) ... Fabaceae s. l. ( Leguminosae , nom. alt.) ... Lamiaceae ( Labiatae , nom. alt.) ... Umbelliferae ( Apiaceae , nom. alter.) ... Liliaceae s. l. Poaceae ( Gramineae , nom. alt.) ... Phone/fax: 7 (095) 939-2777 . e-mail: alnus@herba.msu.ru . ... Images of living plants . ...

Еще в разделе: (Показать все результаты (>198) - herba.msu.ru/ )

• Pictures of the invertebrates
• Materials of A. Shipunov

... Главная -> Фильмы -> The Big Picture . ... Фильмы . ... The Big Picture . ... Jennifer Jason Leigh . Michael McKean . ... Jason Gould . ... Nancy Valen . ... Richard Blake . ... Scott Coffey . ... Richard Belzer . ... Michael Jocum . ... Valen Watson . Jennifer Karr . ... Scott Williamson . ...

Еще в разделе: (Показать все результаты (>455) - kinfo.ru/ )

• Ed, Edd n Eddy's Big Picture.. - Фильмы - Kinfo.ru
• Team Picture - Фильмы - Kinfo.ru
• Picture Perfect - Фильмы - Kinfo.ru

Борис Михайлович Болотовский (ФИАН) . ... автор книги "Оливер Хевисайд" (см. сайт изд. ... Оливер Хевисайд (1850 - 1925), закончил только неполную среднюю школу, дальнейшие знания получил самостоятельно, путем самообразования. ... Предсказал что в верхних слоях атмосферы существует слой (слой Хевисайда), отражающий электромагнитные волны. ... Аудио запись доклада Б.М. Болотовского ( 58 мин, mp3, 80MB ). ... Б.М. Болотовский начал свой доклад . ... Продолжение доклада. ...

Еще в разделе: (Показать все результаты (>9) - lve.sinp.msu.ru/ )

• All Gell-Mann_Sep25_2007 pictures
• Lubyanka_after_Mar29_2010 pictures
• All Piter_Oct-2010 pictures

... Figure 6.1: Example of the CompHEP menu . Figure 6.2: Example of the Fortran menu . Figure 6.3: Example of the CompHEP tables . Figure 6.4: Example of the CompHEP diagram images . Figure 6.5: Menu scheme for the symbolic session . Figure 6.6: Example of the process input . Figure 6.7: Example of the plot image . Figure 6.8: Menu scheme for the numerical session . ... Figure 6.10: Plot for a 2- 2 process . Figure 6.11: Example of pseudo-graphic diagram image . ...

Еще в разделе: (Показать все результаты (>1603) - theory.sinp.msu.ru/ )

• QFTHEP'2000-Pictures
• staff:kryukov:funny [THEP]