... Each day we feature a different picture of some part of our fascinating universe, along with a brief explanation written by a professional astronomer. Today's Picture: June 20, 1995 . The Pleiades Star Cluster . Picture Credit: Mount Wilson Observatory . ... The blue haze that accompanies them is due to very fine dust which still remains and preferentially reflects the blue light from the stars. We keep an archive of previous Astronomy Pictures of the Day. ...

Еще в разделе: (Показать все результаты (>12020) - www.sai.msu.su/ )

• Astronomy Picture of the Day
• APOD: 2014 September 3 - M6: The Butterfly Cluster
• APOD: July 26, 1995 - M15: A Great Globular Cluster

... December 13, 1997 . The Coma Cluster of Galaxies . ... The Coma Cluster of Galaxies pictured is one of the densest clusters known - it contains thousands of galaxies . Each of these galaxies house billions of stars - just as our own Milky Way Galaxy does. ... In fact, the Coma Cluster is so big it takes light millions of years just to go from one side to the other! Most galaxies in Coma and other clusters are ellipticals , while most galaxies outside of clusters are spirals . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 October 15 - Globular Cluster Omega Centauri
• APOD: May 3, 1997 - Giant Cluster Bends, Breaks Galaxy Images
• APOD: 2000 January 12 - NGC 6791: An Old, Large Open Cluster

... Tombaugh 4 . ... 21.10.2006 . ... But the skilled and careful astronomer also went on to discover star clusters, comets, asteroids, and clusters of galaxies. For example, pictured is galactic or open star cluster Tombaugh 4 in the northern constellation Cassiopeia . ... Publications with keywords: open cluster - star cluster . Publications with words: open cluster - star cluster . ... M45: The Pleiades Star Cluster . ... X Ray Stars of Orion . Starburst Cluster in NGC 3603 . ...

Еще в разделе: (Показать все результаты (>75634) - www.astronet.ru/ )

• The Center of Globular Cluster Omega Centauri
• Abell 2744: Pandoras Cluster of Galaxies
• Globular Cluster Omega Centauri

. The HTMLPAGE uses the client-side imagemap construction.Click the any picture to see full-size and full-color images. If your client don't support client-side imagemap, You can append the filename (under each image) to the URL location Description: . Not available yet ... Best Regards, Pavel Plechov

Еще в разделе: (Показать все результаты (>663) - geo.web.ru/ )

• Index of Kamchatka Pictures

... Description . Catalog . ... In the Catalog, we publish equatorial (ЮБ 2000 , ЮД 2000 ) and galactic (l,b) coordinates of cluster centers derived as the position of overdensity in 2MASS catalog (Koposov et al. ... Distances, color-excesses and ages are the mean-square values calculated using all available evaluations from different color-magnitude diagrams. ... There are individual pages for every cluster where all available plots and parameters are published. ... 2002). ...

Еще в разделе: (Показать все результаты (>222) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Berkeley 97
• SAI OCL Catalog Berkeley 71
• SAI OCL Catalog Czernik 21

Use of humates to remediate polluted environments: . ... Picture gallery of the events . ... Use of different adsorbents (peats, sapropels, ceolites) in remediation technologies . ... Bezuglova, O.S. Use of humates and humate-enzyme complexes for the detoxification of soils contaminated with heavy metals. ... Coffee break . 11:00-12:00 . ... Theory and practice of humates use for remediation of polluted environments . ... Round table discussion: Working groups . ...

Еще в разделе: (Показать все результаты (>153) - mgumus.chem.msu.ru/ )

• Picture gallery of the participants and guests

... Difference between workstation clusters and MPPs . Up: Special features of different systems Next: Checking your machines list Previous: Special features of different systems . ... In contrast, workstation clusters require that each process in a parallel job be started individually, though programs to help start these processes exist (see Using the secure server below). ... Using heterogeneous clusters is discussed below.) ... Центры . ...

Еще в разделе: (Показать все результаты (>444) - www.parallel.ru/ )

• Special features of different systems | PARALLEL.RU -

Norwegian Libraries: . ... ARLIS - Kunstbib: Norwegian Art History Bibliography. ... The Norwegian Museum of Architecture . ... Art Museums . ... Henie-Onstad Art Center - Hovikodden: Norway's first Museum of Fine Arts on Internet. The Astrup Fearnley Museum of Modern Art . ... National Museum of American Art . Dallas Museum of Art . ... Electra '96 Henie Onstad Art Center's Project for Electronic Media. ... WWW-Library: History of Art . ... News: rec.fine.arts . ... News: k12.ed.art . ...

Еще в разделе: (Показать все результаты (>7) - www.hist.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>145) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• RNA secondary structure prediction
• TreeTop - Phylogenetic Tree prediction

... Kopper K. - The Linux Enterprise Cluster: Build a Highly Available Cluster with Commodity Hardware and Free Software . ... Название: The Linux Enterprise Cluster: Build a Highly Available Cluster with Commodity Hardware and Free Software . ... The Linux Enterprise Cluster explains how to take a numberof inexpensive computers with limited resources, place them on a normal computer network, and install free software so that the computers act together like one powerful server. ...

Еще в разделе: (Показать все результаты (>12101) - lib.mexmat.ru/ )

• Tuxworth N. - Clothes: A Very First Picture Book :: Электронная библиотека
• Nemoodar S., Sandy J. - Orthodontics: Picture Test Atlas :: Электронная
• Поиск книг, содержащих picture (окружение) :: Электронная библиотека

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: give the motion picture to a considerably . ... Are you presently now contemplating about getting a few of designer <a href=http://www.discountedsunglassesonline.net/#201>cheap oakley flak jacket xlj sunglasses</a> sunglasses? ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>5995) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: provide the motion picture to
• Экологический Форум - Фундаментальная Экология: give the motion picture to the
• Экологический Форум - Фундаментальная Экология: Require Picture taking

Calendars Order images | ... Calendars . ... We collect our best pictures for calendars sets. ... Volcanoes of Kamchatka . Best shots of Kamchatka's volcanoes. ... Volcanoes at winter. ... Kamchatka . Fastination landscapes of famous kamchatka's Gaiser's Valley. ... Kamchatka: volcanoes, sea and ice . 13 best shots of different Kamchatka's landscapes - sea cost, icebergs, frosen sea, storming sea, volcanoes. ... Orders can be made via e-mail, or post. ... EcoPhoto Imagery . ...

Еще в разделе: (Показать все результаты (>554) - www.fadr.msu.ru/ )

• "EcoPhoto" - Collection - Order photo

This example shows how to make, store to file, and read a picture as a set of drawing commands. ... This example ** program may be used, distributed and modified without limitation. ** *****************************************************************************/ # include ctype.h # include qapplication.h # include qpainter.h # include qpicture.h # include qpixmap.h # include qwidget.h # include qmessagebox.h # include qfile.h void paintCar( QPainter *p ) // ...

Еще в разделе: (Показать все результаты (>516) - rtm-cs.sinp.msu.ru/ )

• Pictures of Most Widgets
• Qt Toolkit - QPicture Class

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>3) - mouse.genebee.msu.ru/ )

... Alliance-3.0 (EDA/VLSI design tools) (by Christoph Jaeschke , probably requires LessTif ) . ... 01oct98) Nedit 5.0.2 editor , (by Alexander Mai , see also version 5.01 , by Greg Kondrasuk , requires LessTif ) . ... 28jan98) XMGR plotting software (by Alexander Mai ) . ... 28jan98) Nedit 5.01 (by Alexander Mai , requires LessTif ) . ... 07apr98) XDIR 2.1 , File mgr and ftp (by Alexander Mai , requires LessTif ) . 28jan98) XFTP 2.1 (by Alexander Mai , requires LessTif ) . ...

Еще в разделе: (Показать все результаты (>4250) - crydee.sai.msu.ru/ )

• "Can You Picture That"
• Photo album: Italy: Florence and Rome, September 1999
• Moving Pictures Songlist

. To see a Russian version of this page, click here . (Professor, Director of SAI. Graduated from the Moscow State University (MSU) in 1964, Ph.D. 1967, MSU, Dr. of Science 1975, MSU) . A member of IAU and EAS, IAU committees No 42, 27. Fields of interest: Stellar astrophysics, close binary systems, inverse problems in astrophysics. Send your mail to: cher@sai.msu.su .

Еще в разделе: (Показать все результаты (>11) - uranus.sai.msu.ru/ )

All Windows PC GAMESS/Firefly versions are parallel but can work in serial (sequential) mode. ... This library defines a particular implementation of MPI the PC GAMESS will use. At present, there are the following dlls available in the BINDINGS folder of PC GAMESS/Firefly installation directory: . ... The recommended MPI implementation for PC GAMESS/Firefly running in parallel on self-made (non CCS-based) Windows clusters is NT-MPICH. ... Parallel Windows Instructions: NT-MPICH . ...

Еще в разделе: (Показать все результаты (>99) - classic.chem.msu.su/ )

• Firefly Home Page
• Lesson 1: getting the most power of your multicore, SMP system or cluster with

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>107) - neptun.sai.msu.ru/ )

• Apache module mod_unique_id

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Methodology of stereoscopic motion picture quality assessment . ... Conference Paper . ... Conference Name . Stereoscopic Displays and Applications XXIV, Proc. of SPIE-IS&T Electronic Imaging, SPIE . ... http://compression.ru/video/vqmt3d/papers/Methodology%20for%20Stereoscopic%20Motion-picture%20Quality%20Assessment.pdf . ...

Еще в разделе: (Показать все результаты (>202) - graphics.cs.msu.ru/ )

• Methodology of stereoscopic motion picture quality assessment | Лаборатория
• Removal of comb effect from video | Лаборатория компьютерной графики и
• Removal of comb effect from video | Graphics and Media Lab

.

Еще в разделе: (Показать все результаты (>209) - comet.sai.msu.ru/ )

• Description of different types of shell
• Washington 2002 + few El Paso pictures
• Pictures of Crimea