... Reserved Keys . ... The following keys are reserved. An implementation is not required to interpret these keys, but if it does interpret the key, it must provide the functionality described. { host} . Value is a hostname. The format of the hostname is determined by the implementation. { arch} . ... The format of path is determined by the implementation. { file} . ... The format of the filename and internal format of the file are determined by the implementation. { soft} . ... Центры . ...

Еще в разделе: (Показать все результаты (>284) - www.parallel.ru/ )

• Reserved Key Values | PARALLEL.RU - Информационно-аналитический центр по
• Client/Server Examples | PARALLEL.RU - Информационно-аналитический центр по

PHP Manual . Prev . Next . Here is the list of PHP reserved words, usually constants and predefined variables . You won't find any functions here, but rather language constructs. You shouldn't try to use such names as variable, function, constant or method names, as it will surely lead to confusion. and . ... old_function . ... argc . ... PHP_OS . ... PHP_SELF . ... PHP_VERSION . ... function . ... HTTP_SERVER_VARS . ... list() . ... List of Function Aliases . ...

Еще в разделе: (Показать все результаты (>638) - oit.cmc.msu.ru/ )

Планеты во Вселенной . Курс лекций для студентов астрономического отделения . Есть ли основания полагать, что планеты являются распространенным явлением во Вселенной? Может ли служить наша Солнечная система типичным примером или она уникальна? ... Эта странная Солнечная система . ... Так рождаются планеты? ... Отдела исследований Луны и планет: . ... к.ф.м.н. Ж.Ф.Родионова . к.ф.м.н. В.В.Бусарев . ... Карты Меркурия Ж.Ф.Родионова . ... Карты Луны Ж.Ф.Родионова . ... Луны и планет . ...

Еще в разделе: (Показать все результаты (>218) - selena.sai.msu.ru/ )

• Mikhail V. Goryachev
• Луноход1
• Morphological Catalogue Of The Craters Of Mars

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ­ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : « , - ». Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>24) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/venturecapital_rus.pdf
• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>19381) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2606.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc5398.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc5398.txt.pdf

Listing of CSS class names emitted from TWiki core code and standard plugins, for the Dakar release. ... TWiki styles in core code . TWiki Styles in Plugins . ... TWiki Styles in Templates . ... Most html elements generated by TWiki core code now have Cascading Style Sheet (CSS) tags. Skin builders and others who want to change the appearance of the default TWiki installation or any of the skins can use this document to see what styles can be created for these html elements. ...

Еще в разделе: (Показать все результаты (>35519) - dualopt1.cmm.msu.ru/ )

• TWikiCss - TWiki - TWiki
• %TOPICTITLE% (6 vs. 7) - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki

The QWindow class is reserved for future extensions. More... #include < qwindow.h > . Inherits QWidget . ... QWindow  ( QWidget * parent=0, const char * name=0, WFlags f=0 )  . QWindow  ()  . ... This class is not yet finished. ... Constructs a window named name, which will be a child widget of parent. ... This file is part of the Qt toolkit , copyright 1995-98 Troll Tech , all rights reserved. ... qwindow.h: 1998/07/03 . qwindow.cpp: 1998/07/03 . Copyright © 1998 Troll Tech . ...

Еще в разделе: (Показать все результаты (>750) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - dclock/dclock.cpp example file
• Qt Toolkit - aclock/aclock.cpp example file
• Qt Toolkit - qwindowdefs.h include file

... Amin S., Das J., Goldshtein M. - Are You Being Served?: New Tools for Measuring Service Delivery. ... Название: Are You Being Served?: ... Авторы: Amin S., Das J., Goldshtein M. Аннотация: . This publication presents tools and techniques for measuring service delivery in health and education and people's experiences from the field in deploying these methods. ...

Еще в разделе: (Показать все результаты (>9565) - lib.mexmat.ru/ )

• Wit G.W. - Loss reserving methods :: Электронная библиотека попечительского
• Thurston C.M. - Language Is Served: Games, Writing Prompts, and Other Language
• Henderson K. - The Guru's Guide to SQL Server Architecture and Internals ::

Boat tour and banquet on Moskva River . ... We have reserved a boat which goes by the Moskva River that crosses the city of Moscow. ... The advanced reservation by e-mail will be considered first. ... The ticket price is $25 for full participants (who have paid $250-$300), and $50 for the accompanying persons and those who paid reduced fee. ... Registration fee: full ($250-300), reduced, or student, or "no fee" (for the accompanying person.) ...

Еще в разделе: (Показать все результаты (>162) - acs366.phys.msu.su/ )

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>1133) - kodomo.cmm.msu.ru/ )

• Term2
• Term4
• Term1

Московский государственный университет имени М.В.Ломоносова Основан в 1755 году . ... МГУ имени М.В.Ломоносова . ... 8 апреля 2016 года в Ломоносовском корпусе МГУ имени М.В.Ломоносова состоялась церемония награждения победителей и призеров олимпиады ?Покори Воробьевы горы!? ... 6 апреля 2016 года в МГУ состоялся очередной концерт из цикла ?Ректор Московского университета приглашает?? ... Московский государственный университет имени М.В.Ломоносова . ... Copyright 1997?2016 МГУ имени М.В.Ломоносова . ...

Еще в разделе: (Показать все результаты (>42) - www.msu.ru/ )

• Exploration for Mineral Deposits

... 2002 December 13 . The Crown of the Sun . ... Explanation: During a total solar eclipse, the Sun's extensive outer atmosphere or corona is an awesome and inspirational sight . ... The camera's design incorporates a precisely made filter whose density, or ability to block light, decreases markedly with distance from the filter center, compensating for the difference between the brighter inner portion of the corona at the Sun's edge and the much fainter outer regions. ... About APOD | ...

Еще в разделе: (Показать все результаты (>7569) - www.sai.msu.su/ )

• APOD: March 26, 1997 - The City Comet
• APOD: September 1, 1995 - Subrahmanyan Chandrasekhar 1910-1995
• APOD: January 12, 1998 - The Keyhole Nebula

... О физическом факультете . ... Журнал "Ученые записки физич. факультета МГУ" . ... Журнал "Ученые записки физического факультета МГУ" . ... Секция физики конференции "Ломоносовские чтения" будет работать на физическом факультете с 18 по 27 апреля 2016 г. 15.04.2016 Конференция проектных и исследовательских работ школьников 'От атома до галактики' . ... Заседания секции "Физика" конференции студентов, аспирантов и молодых ученых "Ломоносов 2016" на физическом факультете состоятся 14 апреля. ...

Еще в разделе: (Показать все результаты (>93) - phys.msu.ru/ )

Astronomy Picture of the Day . ... 12.01.1998 . ... Officially designated NGC 3324, the Keyhole Nebula is a smaller region superposed on the larger Eta Carina Nebula . ... An emission nebula that contains much dust , the Keyhole Nebula is roughly 9,000 light years distant. ... 1997 1998 . ... NASA Web Site Statements, Warnings, and Disclaimers . ... Publications with keywords: emission nebula - Keyhole Nebula - Eta Carinae . Publications with words: emission nebula - Keyhole Nebula - Eta Carinae . ...

Еще в разделе: (Показать все результаты (>33767) - www.astronet.ru/ )

• Subrahmanyan Chandrasekhar 1910-1995
• Journal "Peremennye Zvezdy"
• Астронет > The Crown of the Sun

... On the Institute . ... Journals about time . ... The International Society for the Study of Time . ... http://kronoscope.net - KronoScope: Journal for the Study of Time . ... The Experience and Perception of Time . ... http://www.timestructures.com/intro.html - the research organization "Time structures" . ... http://www.been.at/timetravel - the Time Travel Research Center . ... Welcome to the Home of Time! ... http://www.theavalonfoundation.org/kozyrev.htm - N.A. Reiter and L.L. Schillig. ...

Еще в разделе: (Показать все результаты (>1127) - chronos.msu.ru/ )

• Laboratory-chair of Discrete mechanics on a microscopic scale
• On the Institute
• Updates

... Главная -> Фильмы -> You Got Served . ... Фильмы . ... You Got Served . ... США 2004 . ... Chris Stokes . ... Lil' Fizz . ... Jerome Jones . ... Malcolm David Kelley . ... Christopher Jones . ... Irene Stokes . ... Kimberly 'Lil' Kim' Jones . ... David 'Elsewhere' Bernal . ... Aminah Abdul-Jillil . ...

Еще в разделе: (Показать все результаты (>110) - kinfo.ru/ )

• Are You Being Served? - Фильмы - Kinfo.ru
• Time Served - Фильмы - Kinfo.ru
• You Got Served, Take It to t.. - Фильмы - Kinfo.ru

. Адрес: 119992, ГСП-2, Москва, Ленинские горы, МГУ, Главное здание, А-1008 . тел.: (095) 939 37 67 факс: (095) 939 02 59 . Все права на материалы, опубликованные на сайте Управления, принадлежат МГУ им.М.В. Ломоносова. При использовании материалов сайта ссылка на наши выходные данные обязательна. Просим сообщать нам о замеченных неточностях и опечатках. Webmaster . 2002-2005 УОСиП МГУ All rights reserved .

Еще в разделе: (Показать все результаты (>10) - www.edst.msu.ru/ )

• Информация

What is a Handler . ... mod_actions . ... A "handler" is an internal Apache representation of the action to be performed when a file is called. Generally, files have implicit handlers, based on the file type. Normally, all files are simply served by the server, but certain file types are "handled" separately. Apache 1.1 adds the ability to use handlers explicitly. ... The following directives will enable the send-as-is handler, which is used for files which contain their own HTTP headers. ...

Еще в разделе: (Показать все результаты (>133) - neptun.sai.msu.ru/ )

• Server-Wide Configuration
• Apache module mod_status
• Manual Page: logresolve - Apache HTTP Server

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ab is a tool for benchmarking your Apache Hypertext Transfer Protocol (HTTP) server. ... This especially shows you how many requests per second your Apache installation is capable of serving. ... The default is to just perform a single request which usually leads to non-representative benchmarking results. -p POST-file . ... Use a proxy server for the requests. -y <tr>-attributes . ...

Еще в разделе: (Показать все результаты (>1427) - uneex.lorien.cs.msu.su/ )

• Apache mod_rewrite Technical Details - Apache HTTP Server
• worker - Apache HTTP Server
• mod_speling - Apache HTTP Server

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ... ab is a tool for benchmarking your Apache Hypertext Transfer Protocol (HTTP) server. ... This especially shows you how many requests per second your Apache installation is capable of serving. ... The default is to just perform a single request which usually leads to non-representative benchmarking results. -p POST-file . ... Use a proxy server for the requests. -y <tr>-attributes . ...

Еще в разделе: (Показать все результаты (>572) - itpm.msu.su/ )

• Apache's Handler Use - Apache HTTP Server
• MySQL Reference Manual for version 3.23.10-alpha. - J The MySQL server license
• worker - Apache HTTP Server