Электронная библиотека Попечительского совета . ... Alexander J.W. - An Example of a Simply Connected Surface Bounding a Region which is not Simply Connected . ... Название: An Example of a Simply Connected Surface Bounding a Region which is not Simply Connected . Автор: Alexander J.W. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10823) - lib.mexmat.ru/ )

• Pap E. - Complex Analysis Through Examples And Exercises :: Электронная
• Журнал Probability and Statistics by Example :: Электронная библиотека

... This file is part of an example program for Qt. This example ** program may be used, distributed and modified without limitation. ** ******************************************************* ... */ #include qwidget.h #include qpainter.h #include qapplication.h #include stdlib.h const int MAXPOINTS = 2000; // maximum number of points const int MAXCOLORS = 40; // // ConnectWidget - draws connected lines // class ConnectWidget : public QWidget { public: ...

Еще в разделе: (Показать все результаты (>711) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - Example Programs
• Qt Toolkit - progress/progress.cpp example file
• Qt Toolkit - pref/pref.cpp example file

... LDAP is the Lightweight Directory Access Protocol, and is a protocol used to access "Directory Servers". ... Search surname entry $sr= ldap _ search ($ds, o=My Company, c=US , sn=S* ); echo Search result is .$sr. p ; echo Number of entires returned is . ldap _count_ entries ($ds,$sr). p ; echo Getting entries ... p ; $info = ldap _ get _ entries ($ds, $sr); ... ldap_get_attributes -- Get attributes from a search result entry . ... ldap_get_entries -- Get all result entries...

Еще в разделе: (Показать все результаты (>1001) - oit.cmc.msu.ru/ )

• ovrimos_connect
• gmdate
• eregi

. To connect to your account on the remote system known as "castor": telnet castor Trying 129.215.112.8 ... Connected to castor.ucs.ed.ac.uk. Escape character is '^]'. SunOS UNIX (castor) login: . To start a telnet session and open a connection to the host "mstore-1": telnet telnet> open mstore-1 Trying 129.215.112.1 ... Connected to mstore-1.ucs.ed.ac.uk. Escape character is '^]'. SunOS UNIX (mstore-1) login: .

Еще в разделе: (Показать все результаты (>510) - comet.sai.msu.ru/ )

• Examples of using pipelines to connect commands
• Example of using anonymous ftp
• Examples of opening a connection to a remote host

... Client/Server Examples . ... Up: Client/Server Examples Next: Ocean/Atmosphere - Relies on Name Publishing Previous: Client/Server Examples . The following example shows the simplest way to use the client/server interface. ... Up: Client/Server Examples Next: Simple Client-Server Example. ... MPI_Open_port(MPI_INFO_NULL, port_name); MPI_Publish_name("ocean", MPI_INFO_NULL, port_name); . ... MPI_Comm_connect( port_name, MPI_INFO_NULL, 0, MPI_COMM_WORLD, &server ); . ... Центры . ...

Еще в разделе: (Показать все результаты (>606) - www.parallel.ru/ )

• Spawn Example | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Inter-Communication Examples | PARALLEL.RU - Информационно-аналитический центр
• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным

... TWiki ? RegularExpression . ... Regular expressions (REs), unlike simple queries, allow you to search for text which matches a particular pattern. ... The fundamental building blocks are the regular expressions that match a single character. Most characters, including all letters and digits, are regular expressions that match themselves. ... Two regular expressions may be joined by the infix operator |; the resulting regular expression matches any string matching either subexpression. ...

Еще в разделе: (Показать все результаты (>40142) - dualopt1.cmm.msu.ru/ )

• RegularExpression - TWiki - TWiki - (printable)
• %TOPICTITLE% (1 vs. 2) - TWiki
• %TOPICTITLE% (3 vs. 4) - TWiki

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>61) - geophys.geol.msu.ru/ )

• TES. Field example.
• Anis. Page2
• TES tecnology. MSU.

... Consider the Virtual Brewery, a small company that brews, as the name indicates, virtual beer. To manage their business more efficiently, the virtual brewers want to network their computers, which all happen to be PCs running a bright and shiny 1.0. ... They run an Ethernet of their own. Quite naturally, the two companies want to link their networks once they are operational. As a first step, they want to set up a gateway host that forwards datagrams between the two subnets. ...

Еще в разделе: (Показать все результаты (>505) - itpm.msu.su/ )

• mod_example - Apache HTTP Server
• mod_cgid - Apache HTTP Server
• mod_vhost_alias - Apache HTTP Server

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>103) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache's Handler Use
• Apache module mod_access

Modules | ... Apache HTTP Server Version 2.0 . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... If you link it into your server, enable the "example-handler" handler for a location, and then browse to that location, you will see a display of some of the tracing the example module did as the various callbacks were made. ... Using the mod_example Module . ...

Еще в разделе: (Показать все результаты (>850) - uneex.lorien.cs.msu.su/ )

• mod_cgid - Apache HTTP Server
• mod_vhost_alias - Apache HTTP Server
• LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples - UNИX

The %INCLUDE{...}% macro embeds the content of the specified topic at the place where the INCLUDE is used. The whole content or only parts of of a page can be included. ... INCLUDE{ "page" pattern="reg-exp" rev="2" warn="off" section="clients" PARAMETER1="value" PARAMETER2="Some value" }% . ... You include the topic with this line %INCLUDE{"MyTopic" BETTER="apples" WORSE="Oranges"}% . ... This topic: System > WebHome > ReferenceManual > UserDocumentationCategory > IncludeTopicsAndWebPages . ...

Еще в разделе: (Показать все результаты (>6755) - wiki.cmc.msu.ru/ )

• FamFamFamContrib < System < Foswiki
• VarADDTOZONE < System < Foswiki

The %INCLUDE{...}% macro embeds the content of the specified topic at the place where the INCLUDE is used. The whole content or only parts of of a page can be included. ... INCLUDE{ "page" pattern="reg-exp" rev="2" warn="off" section="clients" PARAMETER1="value" PARAMETER2="Some value" }% . ... You include the topic with this line %INCLUDE{"MyTopic" BETTER="apples" WORSE="Oranges"}% . ... This topic: System > WebHome > ReferenceManual > UserDocumentationCategory > IncludeTopicsAndWebPages . ...

Еще в разделе: (Показать все результаты (>2176) - wiki.cs.msu.ru/ )

• YahooUserInterfaceContrib < System < Foswiki
• (backlinks in System Web) TimBernersLee < System < Foswiki
• (backlinks in all Webs) TimBernersLee < System < Foswiki

This diagram illustrates two block boxes, one above the other, with rectangular clipping regions of different dimensions. ... Both axes depict increments of 5px. The clipping region of the first P box lies entirely within it, offset 5px from the top and left edges of the P box, and 10px from the right and bottom edges. ... The clipping region of the second P box resembles that of the first in style and position, except that the right edge is 5px to the right of the P box's right edge. ...

Еще в разделе: (Показать все результаты (>4067) - crydee.sai.msu.ru/ )

• Long description of example illustrating the collapsing borders model
• A Simple Example With a Single Chirp Component
• Long description for example showing how structurally overlapping cells are

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>7) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

... Of course, you need to have iwconfig installled on your system. ... matching is done on the first 3 bytes of the MAC address # SMC2835W EZ Connect g 2.4GHz 54 Mbps Wireless Cardbus Adapter 00:04:E2:*) INFO = SMC2835W EZ Connect g 2.4GHz 54 Mbps Wireless Cardbus Adapter # ESSID (extended network name) : My Network, any ESSID = any # NWID/Domain (cell identifier) : 89AB, 100, off NWID= # Operation mode : Ad-Hoc, Managed, Master, Repeater, Secondary, auto MODE = Managed # Frequency or ...

Еще в разделе: (Показать все результаты (>20807) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/dev-ml/lablgtk/lablgtk-2.18.0-r1.ebuild
• http://mirror.msu.net/pub/gentoo-portage/dev-ml/lablgtk/lablgtk-2.18.3.ebuild
• http://mirror.msu.net/pub/gentoo-portage/dev-ml/lablgtk/lablgtk-2.18.2.ebuild

We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>897) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>70) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1426) - kodomo.cmm.msu.ru/ )

• examples.zip тАУ Cyclyc Cell Automata
• WikiRestructuredText тАУ Tanchiki

... graph . ... 20 >>> g.fast_cliques() . ... 37 def copy ( self ): . ... 52 def drop_vertex ( self , vertex ): . ... 60 def vertex_weight ( self , vertex ): . ... 64 def vertex_index ( self , vertex ): . ... 67 def add_vertex ( self , vertex , parent_graph ): . ... 91 def __init__ ( call , candidates , used , compsub ): . ... 96 def get_v_from_candidates ( call ): . ... 100 def used_candidates ( call ): . ... 110 def __call__ ( call ): . ... 156 def expand_to_max_clique ( self , parent_graph ): . ...

Еще в разделе: (Показать все результаты (>12251) - kodomo.fbb.msu.ru/ )

• allpy: b520e79fd1f4 allpy/graph.py
• allpy: 934d52e3181b allpy/graph.py
• Index of /FBB/year_06/term1/Pr_7/Examples