... Laboratory of Mathematical Methods of Image Processing . ... Image analysis . ... Ringing effect . ... It can be efficiently used as a post-processing method for global image deblurring methods . ... Development of edge width estimation algorithm is important for image enhancement and image quality analysis methods. ... Ringing effect so known as Gibbs phenomenon in mathematical methods of image processing is the annoying effect in images and video appeared as rippling artifact near sharp edges. ...

Еще в разделе: (Показать все результаты (>363) - imaging.cmc.msu.ru/ )

... Levitskaya O., Glazko V.I. Centre of experimental embryology and reproductive biotechnology Russian Academy of Agricultural Sciences e-mail: sotnikova.evgeniya@gmail.com For a comparative analysis of the prevalence of nucleotide substitutions in different genes of the proviral DNA of bovine leukemia virus in our studies performed comparing the frequency nucleotide substitutions and nonsynonymous to synonymous substitutions ratio (Kn/s) in the coding sequences of genes env and pol. ...

Еще в разделе: (Показать все результаты (>333) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf
• OMICS Startup Contest

... MSU Codec Comparison aims to deliver high quality comparisons of video encoders to both industrial and scientific communities. ... The newest versions of MPEG-4 codecs comparison for their using by an ordinary user for home video compression. ... First Annual MPEG-4 AVC/ H.264 Video Codecs Comparison (January 2005) . ... Second Annual MPEG-4 AVC/H.264 Video Codecs Comparison(December 2005) . ... Third Annual MPEG-4 AVC/H.264 Video Codecs Comparison (December 2006) . ... Fifth H.264 codecs comparison...

Еще в разделе: (Показать все результаты (>417) - graphics.cs.msu.ru/ )

• MSU Video Codec Comparison | Лаборатория компьютерной графики и мультимедиа
• x264 codec improvement | Graphics and Media Lab
• Video Frame Rate Double Up-Conversion | Лаборатория компьютерной графики и

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>249) - www.genebee.msu.ru/ )

• Screening protein sequence against PROSITE databank
• BioSystems, 30 (1993) 57-63 57
• Fasta3 help

Astronomy Picture of the Day . La Palma Eclipse Sequence . ... Credit Copyright: Miguel Claro ( TWAN ) Explanation: At left, a dramatic image sequence follows late September's total lunar eclipse above a rugged landscape and sea of clouds from the Canary island of La Palma . Composited in a circular fisheye projection, the brightness of the Full Perigee Moon changes drastically in transition from outside the total eclipse phase compared to its dim glow during the 72 minute long totality . ...

Еще в разделе: (Показать все результаты (>7647) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > La Palma Eclipse Sequence

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• SDPlight
• Input Formats

... The following charts/text are intended as tools for monitoring the Type Ia supernovae ( SNe ) event visually or photographically (utilizing telescope equipped CCD equipment).The files include: A replication of The Type Ia SNe , V- magnitude (with data point checks from other cited references)and color index (B-V) templete (to indicate a general color-related trend of the type Ia ... I believe this might help alleviate some of the problems involving the making of acceptable amateur light curves...

Еще в разделе: (Показать все результаты (>3531) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - Dotter
• Supernovae Charts.
• APOD: 2015 October 7 - La Palma Eclipse Sequence

PHP Manual . ... PHP 4 >= 4.0.2) ldap_compare -- Compare value of attribute found in entry specified with DN . int ldap_compare ( int link_identifier, string dn, string attribute, string value) . ... Returns -1 on error. ldap_compare() is used to compare value of attribute to value of same attribute in LDAP directory entry specified with dn . The following example demonstrates how to check whether or not given password matches the one defined in DN specified entry. Example 1. ...

Еще в разделе: (Показать все результаты (>555) - oit.cmc.msu.ru/ )

• switch
• dbx_compare

... Parsimony method . ... It is based on the following principle: the ancestral sequences (posed in nodes of a phylogenetic tree) should be such that the minimal required number of character replacements on the branches of the tree is less than for any other choice of sequences. ... If the preliminary character of the node is * , but the output character of its immediate ancestor is some letter (say, X ), and its set of possible characters contains X , then the output character of the node is also X . ...

Еще в разделе: (Показать все результаты (>3204) - monkey.belozersky.msu.ru/ )

• About this project
• Inquiry information || Rule of four sequences
• Inquiry information || Distances

... We compared the possibilities of applying of two different kinetic models for the determination of reaction rate constants in micelles. ... The pseudophase model can be used to estimate the reaction kinetics in micelles only in cases b and c. If the decay deviates insignificantly from an exponential decay, the accurate determination of the rate constants from decay data will be virtually impossible by any of the discussed kinetic models. ...

Еще в разделе: (Показать все результаты (>1017) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Moscow University Chemistry Bulletin Vol. 50, No. 6, P. 411 (2009)
• Moscow University Chemistry Bulletin Vol. 56, No. 4, P. 212 (2015)

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... Unless in many other approaches to the analysis of different signal coupling, the information entering the analysis of synchronization in our approach is explicitly represented in the form of elementary, instantaneous events (the change-points). ... Hence the use of correlation/coherency estimates in parallel with change-point analysis seems to be quite rational. ...

Еще в разделе: (Показать все результаты (>69) - brain.bio.msu.ru/ )

• Change-point detection algorithm performance with real EEG
• Change-points in EEG components with different pattern
• Nonparametric approaches to the description of EEG piecewise stationary

... 2 ZERO-ORDERED SEQUENCES OF SPARSE VECTORS Let X = {xk } be a sequence of sparse vectors from Kn, I = {ik } be a sequence of multiindices. ... L ..... uL x1 ..... x1 ..... xn NNp-1 u1 u p-1 xn NNp-1 u1 NN p up-1 ..... up Let's consider a following sequential chain SPN of linked -neurons: u1 = spn1(x), up = spnp(x, up-1), 7 where p = 2, . ... We learn -neurons spn1, . ... Let's consider a following multy-layered network SPNN of -neurons: u1 = spn1(x), up = spnp(x, up-1), where p = 2, . ... SPNp-1(x))...

Еще в разделе: (Показать все результаты (>69) - acat02.sinp.msu.ru/ )

... E-MAIL ADDRESS: D.Khmelev@newton.cam.ac.uk . A new statistical method in the analysis of literary style for disputed authorship resolution is considered here. ... Consider a sequence of letter of text as a Markov chain. ... Suppose we take the logarithm of each probability, change a sign, and divide it by the length of control text; then each of the numbers obtained is called the relative empirical entropy . Relative empirical entropy is more convenient for computing than actual probabilities. ...

Еще в разделе: (Показать все результаты (>80) - old.philol.msu.ru/ )

• MSU-LGCLL:: Krylov J.K.- Three Laws of Fiction Prosaic Texts Organization
• MSU-LGCLL:: DicTUM-1 - A System for Dictionary-Text Universal Manipulations and

... Loskutov, and E. V. Ryadchenko Presented by Academician A.R. Khokhlov April 22, 2005 Received April 26, 2005 The problem of the identification and biological significance of chromosome fragments and complete genomes is approached on the basis of the representation of a sequence of DNA nucleotides as a two-dimensional walk. ... However, as applied to DNA, functional and structural fragments of a chromosome may be distinguished by a typical walk "pattern" only for a sufficiently large number of units....

Еще в разделе: (Показать все результаты (>77) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/Inform_safety.pdf

BLASTCLUST - BLAST score-based single-linkage clustering. ... BLASTCLUST automatically and systematically clusters protein or DNA sequences based on pairwise matches found using the BLAST algorithm in case of proteins or Mega BLAST algorithm for DNA. ... The primary input format for BLASTCLUST is a FASTA-format sequence file. ... Another type of input is a sequence hit-list previously saved by BLASTCLUST (in this case BLASTCLUST will use pre-computed HSP data instead of making de novo comparisons). ...

Еще в разделе: (Показать все результаты (>5199) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_04/doc/term3/fasta_man.txt
• http://kodomo.cmm.msu.ru/~mikhail88/term4/evolution.files/msbar.txt
• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/impala.html

... Comparison of computational efficiency of explicit and implicit schemes for the sediment transport problem in coastal zones" . Sukhinov A.I., Protsenko E.A., Chistyakov A.E., and Shreter S.A. An unsteady spatial two-dimensional sediment transport model in coastal zones is considered. ... Keywords: mathematical model, sediment transport, distributed computing, parallel programming, dynamics of marine sediments, shallow water equations, diffusion-convection-reaction equation. ...

Еще в разделе: (Показать все результаты (>685) - num-meth.srcc.msu.ru/ )

• "Regular algorithms for the analysis of radio-location images"
• "Optimization algorithms for facet models and methods of their network...
• "A comparative analysis of protective arms of central Asian nomads with the

Электронная библиотека Попечительского совета . ... Pedersen C.N.S. - Algorithms in Computational Biology . ... Название: Algorithms in Computational Biology . Автор: Pedersen C.N.S. Аннотация: . ... area called computational biology, or bioinformatics, that focuses on utilizing . ... majority of problems in computational biology relate to molecular or evolutionary . ... We contribute to the eld of computational biology . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>16986) - lib.mexmat.ru/ )

• Percus J.K. - Mathematics of genome analysis :: Электронная библиотека
• Carstensen B. - Comparing and predicting between several methods of measurement
• Hartle T. - Comparing Indicators: Stochastics %K versus Williams' %R ::

... We obtained 20 complete cytochrome b sequences (1140 bp) of Meles leucurus from the Korean Peninsula (mainland Korea and Jeju Island), Russian Far East, and Mongolia, and these sequences were compared to complete and partial (629 bp) sequences of M. leucurus , obtained from GenBank, in order to reexamine genetic differentiation among M. leucurus from Korea, Siberian and Far-eastern Russia, Mongolia, and China. ...

Еще в разделе: (Показать все результаты (>1424) - zmmu.msu.ru/ )

• Two sympatric phylogroups of the Asian badger Meles leucurus (Carnivora:

Geometrical core (core) is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chains. ... Minimal core size (#aa's) . ... Alternative core new atoms (%) . ... Geometrical core is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chain. ... Each input sequences is aligned to the corresponding sequence obtained from the ATOM section of the protein chain in the PDB file. ...

Еще в разделе: (Показать все результаты (>6962) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis

... Building Packages for Multiple Architectures and Operating Systems . ... This is done by matching information from the build system's uname output against a number of rpmrc file entries. ... Specifically, these entries are used to create a table that maps information from uname to the appropriate architecture/operating system name. ... The --buildarch and --buildos options can be used to set the build-time architecture and operating system rather than relying on RPM's automatic detection...

Еще в разделе: (Показать все результаты (>417) - uneex.lorien.cs.msu.su/ )

• Comparing Linux/UNIX Binary Package Formats
• mod_ldap - Apache HTTP Server
• mod_setenvif - Apache HTTP Server