AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>242) - www.genebee.msu.ru/ )

... IDL typedef octet Bytes[64]; struct S { long len; }; interface A; union U switch (long) { case 1: long x; case 2: Bytes y; case 3: string z; case 4: case 5: S w; default: A obj; }; . ... Unions map to C++ classes with access functions for the union members and discriminant. ... For union Z , calling the _default() member function causes the union's value to be composed solely of the discriminator value of FALSE , since there is no explicit default member. ...

Еще в разделе: (Показать все результаты (>833) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_imap
• Qt Toolkit - QTabBar Class
• Visible bell mini-Howto

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>146) - bioinf.fbb.msu.ru/ )

... x264 is an open source codec of standard MPEG4 AVC/H.264, developed by programmers from all over the world. ... Accumulated during previous frames' compressions statistic is actively used by codec to improve effectiveness of adaptive models. ... These parameters are used only before encoding start, so, our improvements are more significant for short sequences. ... 3 Results of codec x264 modification on "flower" sequence . ... 5 Results of codec x264 modification on "flower" sequence, low bitrates ....

Еще в разделе: (Показать все результаты (>876) - graphics.cs.msu.ru/ )

• GML Texturizer Tutorial | Graphics and Media Lab
• Selected completed projects | Graphics and Media Lab
• Road monitoring | Graphics and Media Lab

... Changed: . Skins overlay regular templates to give different looks and feels to TWiki screens. ... TWiki uses TWikiTemplates files as the basis of all the screens it uses to interact with users. ... TWiki ships with a default set of template files that give a basic look-and-feel. ... TWiki ships with a default set of template files that give a very basic, CSS-themable, look-and-feel. ... Skin files may also be defined in TWiki topics - see TWikiTemplates for details. ... Revision of this file . ...

Еще в разделе: (Показать все результаты (>42534) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (30 vs. 31) - TWiki
• ManagingTopics - TWiki - TWiki
• NatSkinStyleBrowser - TWiki - TWiki - (printable)

... To avoid such nasty commits in the future, add the following lines to your ~/.hgrc: [extensions] hgext.eol = Note: kodomo has this setting on by default. ... 6 def __init__ ( self , * args , ** kw ): . ... init__ ( self , * args , ** kw ) . ... 12 def attach ( self , widget ): . ... 15 widget [ command ] = lambda * args , ** kw : self . ... 17 def _command ( self , * args , ** kw ): . ... 24 def _set ( self , sender , * args , ** kw ): . ... 47 def insert ( self , * args , ** kw ): . ... 79 names . ...

Еще в разделе: (Показать все результаты (>44869) - kodomo.fbb.msu.ru/ )

• allpy: 80043822a41e sandbox/ttk.py
• allpy: 27e866560087 sandbox/ttk.py
• allpy: e461a5529338 sandbox/ttk.py

... To have any effect you must have first created some text by making a text box (the tool to the left of the main screen with ab in the center). Once you have a text box, double click inside it to make the insertion point appear. ... This lets you change the font you are using, the style e.g. change from Bold to Italic, the size and the character set. ... Text -> Color.. This tool is used to change the color of the selected text. ... Click the colored square you want in the display to choose it. ...

Еще в разделе: (Показать все результаты (>837) - uneex.lorien.cs.msu.su/ )

• mod_imap - Apache HTTP Server
• Chapter?а7.?а Painting with GIMP
• Chapter??4.?? Getting unstuck

Permitted Context: SELECT . ... The OPTION element can only occur within a SELECT element. ... When the form is submitted, the NAME of the enclosing SELECT element is paired with the OPTION's VALUE attribute to contribute a name/value pair for the selection. ... CLASS . ... The string to be used together with the name attribute of the enclosing select element, when submitting the form. ... SELECTED . ... This attribute is used within menus to define shaped hotzones associated with this option's value. ...

Еще в разделе: (Показать все результаты (>416) - comet.sai.msu.ru/ )

• Figures
• Did You Know?

Documentation on Firefly v. 8.0.0 numerical gradient features . The numerical gradient code is activated as follows: . ... The primary purpose of this code is to allow computations normally requiring analytic energy gradients, to be performed using those QC methods for which analytic gradients are not yet programmed. ... The numerical gradients code is tightly integrated into Firefly and can be used anywhere where the analytical energy gradients are required by default. ... The default is 2. ...

Еще в разделе: (Показать все результаты (>111) - classic.chem.msu.su/ )

• Firefly/PC GAMESS DOCUMENTATION - NEW MP2 GRADIENT CODE
• PC GAMESS/Firefly DOCUMENTATION - CI SINGLES

IMPALA: Integrating Matrix Profiles And Local Alignments 1. ... Primary preprocessing Prepare the following files : i. a collection of PSI-BLAST-generated profiles with arbitrary names and suffix .chk; ii. a collection of profile master sequences , associated with the profiles , each in a separate file with arbitrary name and a 3 character suffix starting with c; the sequences can have deflines; they need not be sequences in nr or in any other sequence ...

Еще в разделе: (Показать все результаты (>8888) - kodomo.cmm.msu.ru/ )

• Changeset 69:ac96d7c2c7c4 ? Cyclyc Cell Automata
• TracBrowser тАУ Tanchiki
• Changeset 65:766236a9c924 ? Cyclyc Cell Automata

... nop>PatternSkin theme: 2009 ---++ Test this theme <!- Local FOSWIKI _LAYOUT_URL = % URLPARAM { layout default= % PUBURLPATH %/% SYSTEMWEB %/PatternSkinTheme/layout.css }% * Local FOSWIKI _STYLE_URL = % URLPARAM { style default= % PUBURLPATH %/% SYSTEMWEB %/PatternSkinTheme/style.css }% * Local FOSWIKI _COLORS_URL = % URLPARAM { colors default= % PUBURLPATH %/% SYSTEMWEB %/PatternSkinTheme/colors.css }% * ... System . ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>8123) - wiki.cmc.msu.ru/ )

• PatternSkinTheme < System < Foswiki
• ParentList < System < Foswiki

... 18.2 User preferences for colors . ... 18.4 Dynamic outlines: the 'outline' property . ... w-resize| text | ... all elements . ... For example, the 'se-resize' cursor is used when the movement starts from the south-east corner of the box. text . ... For example, if the element is broken across several lines, the outline is the minimum outline that encloses all the element's boxes. ... Graphical user interfaces may use outlines around elements to tell the user which element on the page has the focus ...

Еще в разделе: (Показать все результаты (>6223) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Tutorial on Fortran 90, Digital UNIX
• Summary of the new features in Fortran 90

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>34) - mouse.genebee.msu.ru/ )

• ConClus

This module provides for server-side imagemap processing. ... Configurable generation of imagemap menus. The lines in the imagemap files can have one of several formats: directive value [x,y ...] . ... The directives can come in any order, but are processed in the order they are found in the imagemap file. base Directive . ... Module: mod_imap . ... Its value is overridden by a default directive within the imagemap file. ... Its value is overridden by a base directive within the imagemap file. ...

Еще в разделе: (Показать все результаты (>966) - oit.cmc.msu.ru/ )

• Servers-IIS/PWS
• sesam_seek_row
• Setting which addresses and ports Apache uses

This module provides for server-side imagemap processing. ... Configurable generation of imagemap menus. The lines in the imagemap files can have one of several formats: directive value [x,y ...] . ... The directives can come in any order, but are processed in the order they are found in the imagemap file. base Directive . ... Module: mod_imap . ... Its value is overridden by a default directive within the imagemap file. ... Its value is overridden by a base directive within the imagemap file. ...

Еще в разделе: (Показать все результаты (>123) - neptun.sai.msu.ru/ )

• Setting which addresses and ports Apache uses
• Apache module mod_vhost_alias
• Running Apache for Windows as a Service

Modules | ... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 . ... This document describes what a Multi-Processing Module is and how they are used by the Apache HTTP Server. ... Choosing an MPM . MPM Defaults . The Apache HTTP Server is designed to be a powerful and flexible web server that can work on a very wide variety of platforms in a range of different environments. ... At the user level, MPMs appear much like other Apache modules. ... mpm_winnt . ...

Еще в разделе: (Показать все результаты (>622) - itpm.msu.su/ )

• MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL
• mod_imap - Apache HTTP Server
• Selecting Specific Protocols

... wLake 1.7 . wLake is a tool which allows to identify clusters of a structural water molecules in given superimposed 3D structures. Put your coordinates in PDB format into the text area. Select a distance threshold. Two water molecules from different structures will be concidered as located in the same space point if the distance between centers of oxygen atoms is less than this threshold. ... EACH STRUCTURE INCLUDING ITS WATER MOLECULES MUST BE PRESENTED AS SEPARATE MODEL: EXAMPLE. ...

Еще в разделе: (Показать все результаты (>6990) - mouse.belozersky.msu.ru/ )

• PLANdbAffy: probe-level annotation database for Affymetrix expression
• NPG-explorer

... There are many methods for reconstruction of phylogeny from multiple protein sequence alignments. ... In this work we tried to create expert systems that predict: 1) if the data is good for phylogeny reconstruction by Fitch ґ Margolish (FM) method; 2) which method would work better: FM or UPGMA. ... We used two species sets, first containing 27 Fungi species and second containing 25 Metazoa species. ... From the entire set of alignments, two subsets were extracted, called "good" and "bad". ...

Еще в разделе: (Показать все результаты (>360) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/33.pdf
• MCCMB'13

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>1483) - monkey.belozersky.msu.ru/ )

• Inquiry information || Rule of four sequences
• Inquiry information || Parsimony algorithm
• Inquiry information || Distances

Home :: Personnel :: Ivanov, Viktor Alexandrovich :: List of Publications . V.A. Ivanov, B. Jung, A.N. Semenov, I.A. Nyrkova, A.R. Khokhlov . ... P.G. Khalatur, V.A. Ivanov, N.P. Shusharina, A.R. Khokhlov . ... A.R. Khokhlov, V.A. Ivanov, N.P. Shusharina, P.G. Khalatur . ... V.A. Ivanov, A.V. Chertovich, A.A. Lazutin, N.P. Shusharina, P.G. Khalatur, A.R. Khokhlov . ... A.V. Chertovich, V.A. Ivanov, A.A. Lazutin, A.R. Khokhlov . ... A.R. Khokhlov, V.A. Ivanov, A.V. Chertovich, A.A. Lazutin . ...

Еще в разделе: (Показать все результаты (>283) - polly.phys.msu.ru/ )

• Selected publications of Chertovich, Alexander Viktorovich
• Selected publications of Lazutin, Alexei Alexandrovich
• Selected publications of Kiselyova, Olga Igorevna