... Peptide Sequence Databases . ... BLAST searches can be limited to the results of an Entrez query against the database chosen. ... For example: Mus musculus[Organism] For help in constructing Entrez queries please see the " Writing Advanced Search Statements " section of the Entrez Help document. ... Only following combinations of the Matrix, Open & Extended Gaps are available: Recomended combinations are colored. ... Gap . ... Standard BLAST alignment in pairs of query sequence and database match. ...

Еще в разделе: (Показать все результаты (>245) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.22+ Services Help
• BLAST Frequently Asked Questions (FAQ)

Appendix€аB.€а Reporting Bugs and Requesting Enhancements . ... Reporting the Bug . ... The only thing you do differently is to mark the report as an тАЬ enhancement тАЭ at the appropriate stage, as described below. ... Set this to тАЬ GIMP тАЭ . ... If in spite of your best efforts, you file a bug report and it ends up being resolved as тАЬ Duplicate тАЭ, don't be too upset: it has happened repeatedly to the author of this documentation, who works with GIMP Bugzilla nearly every day. €а . ...

Еще в разделе: (Показать все результаты (>1474) - uneex.lorien.cs.msu.su/ )

PHP Manual . ... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) error_reporting -- set which PHP errors are reported . ... error_reporting (55); // PHP 3 equivalent to E_ALL ^ E_NOTICE /* ...in PHP 4, '55' would mean (E_ERROR | ... error_reporting(0); /* Turn off all reporting */ error_reporting (7); // Old syntax, PHP 2/3 error_reporting (E_ERROR | ... E_PARSE); // New syntax for PHP 3/4 /* Good to use for simple running errors */ error_reporting (15); // Old syntax, PHP 2/3 error_reporting (E_ERROR | ...

Еще в разделе: (Показать все результаты (>666) - oit.cmc.msu.ru/ )

• Error Reporting
• Security
• Reporting Errors

Next: Mixing and Matching Binary Up: Administrivia and Stupid Mail Previous: Running the Sendmail Queue . ... There are a number of ways to quantify mail traffic. Sendmail comes with a utility called mailstats that reads a file called /usr/local/lib/mail/sendmail.st and reports the number of messages and number of bytes transferred by each of the mailers used in the sendmail.cf file. ... There are a number of commonly available utilities that can summarize the output of mail logging from syslogd. ...

Еще в разделе: (Показать все результаты (>493) - itpm.msu.su/ )

• Mixing and Matching Binary Distributions

... intas:cern-intas03:task2 ]] . ... T2.GRID monitor.. ... User Policy . ... GRID monitoring tools . ... Creation of a tool providing users with access to detailed application information in the framework of the GRID paradigm and test it in LCG. ... Development of monitoring tools that produce integrated characteristics by use of statistical information gathered from various GRID elements. ... However, the delivery of such specific information to users through the GRID is not possible in existing GRIDs...

Еще в разделе: (Показать все результаты (>2075) - theory.sinp.msu.ru/ )

• тЬО intas:cern-intas03:task2 [THEP]
• [RU-NGI] [Ru-ngi] [EGEE-SA1-RU] Fwd: Fw: (Urgent) please check the reported
• [Ru-ngi] [EGEE-SA1-RU] Fwd: Fw: (Urgent) please check the reported site

DVM debugger - contents . Part 1 (1 - 4) . ... Writing to read-only variable is detected. ... Using non-initialized element <elem> . ... Using variable <var> before asynchronous reduction competed . ... The dynamic debugger detects access to a shadow element before asynchronous shadow renew competed . ... It is reported when any non-correspondence of trace or loop description file is detected. ... Different values of reduction operation are detected for current event and in reference trace record. ...

Еще в разделе: (Показать все результаты (>224) - sp.cs.msu.ru/ )

Электронная библиотека Попечительского совета . ... Lang T. - Guidelines for Reporting Statistics in Biomedical Research . ... Название: Guidelines for Reporting Statistics in Biomedical Research . Автор: Lang T. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>15223) - lib.mexmat.ru/ )

• Updegraff B. - SQL Server 2005 Reporting Services in Action :: Электронная
• Goff K., Paddock R. - Pro VS 2005 Reporting using SQL Server and Crystal
• Robinson M. - Microsoft SQL Server 2005 Reporting Services For Dummies ::

... Length = 4214630 Score = 44.1 bits (22), Expect = 1e-05 Identities = 22/22 (100%) Strand = Plus / Plus Query: 46 ggtcggtggttcgagtccactc 67 || Sbjct: 31975 ggtcggtggttcgagtccactc 31996 Score = 44.1 bits (22), Expect = 1e-05 Identities = 22/22 (100%) Strand = Plus / Plus Query: 46 ggtcggtggttcgagtccactc 67 || Sbjct: 11507 ggtcggtggttcgagtccactc 11528 Score = 40.1 bits (20), Expect = 2e-04 Identities = 20/20 (100%) Strand = Plus / Minus Query: 8 tagctcagttggttagagca 27 || ...

Еще в разделе: (Показать все результаты (>5580) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~christablel/term3/blastn.1fasta
• http://kodomo.cmm.msu.ru/~pavel_s/term3/blastn.txt
• http://kodomo.cmm.msu.ru/~phoenix/term3/resultblastn2.txt

... Unexpected Galaxy String in the Early Universe . ... 20.01.2004 . ... NSF , NASA Explanation: How could such a long string of galaxies form so early in the universe? Several new measurements of galaxies and clusters in the early universe are reporting structures involving galaxies and clusters that are larger than expected with the new standard "dark-energy" cosmology . ... Publications with keywords: galaxies - early universe . Publications with words: galaxies - early universe . ...

Еще в разделе: (Показать все результаты (>9539) - www.astronet.ru/ )

• Астронет > Unexpected Galaxy String in the Early Universe
• An Aurora Before the Storm
• Journal "Peremennye Zvezdy"

... 2004 January 20 . Unexpected Galaxy String in the Early Universe . ... Explanation: How could such a long string of galaxies form so early in the universe? Several new measurements of galaxies and clusters in the early universe are reporting structures involving galaxies and clusters that are larger than expected with the new standard "dark-energy" cosmology . The controversy centers on the inability of a dark-energy dominated universe to create such large structures. ... About APOD | ...

Еще в разделе: (Показать все результаты (>3652) - www.sai.msu.su/ )

• SAL- Database Systems - Relational DBMS - /rdb
• APOD: 2004 November 23 - Leonid Meteors Streak
• SAL- Database Systems - Relational DBMS - CQL++

... Statistics for Apr 2016 . Reporting on About web . view: 8, save: 0, upload: 0 . ... ERROR: no permission to CHANGE statistics topic in About . Reporting on Education web . ... Reporting on Main web . ... Reporting on People web . ... Reporting on Projects web . ... Reporting on Publications web . ... Reporting on Sandbox web . view: 1101, save: 0, upload: 0 . ... Reporting on TWiki web . view: 241, save: 0, upload: 0 . ... ERROR: no permission to CHANGE statistics topic in TWiki . ...

Еще в разделе: (Показать все результаты (>44095) - dualopt1.cmm.msu.ru/ )

... Length=2222430 Score = 55.4 bits (60), Expect = 6e-08 Identities = 53/68 (78%), Gaps = 0/68 (0%) Strand=Plus/Plus Query 141 TTACTGGGCGTAAAGCGCACGCAGGCGGTTTGTTAAGTCAGATGTGAAATCCCCGGGCTC 200 || Sbjct 1090874 TTACTGGGCTTAAAGCGCCCGTAGCCGGCCCGGCAAGTCGCTCCTGAAATCCCCGGGCTC 1090933 Query 201 AACCTGGG 208 || ... Sbjct 2071246 AGCCGCGGTAATACGG 2071261 Score = 28.3 bits (30), Expect = 8.9 Identities = 15/15 (100%), Gaps = 0/15 (0%) Strand=Plus/Plus Query 222 ACTGGCAAGCTTGAG 236 || ...

Еще в разделе: (Показать все результаты (>34) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Length = 4702289 Score = 751 bits (1939), Expect = 0.0 Identities = 359/457 (78%), Positives = 409/457 (89%) Frame = -2 Query : 1 MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP 60 MS I WDL+LIQKYNYSGPRYTSYPTALEFSED+ E AF QAV RYP+RPLSLYVHIP Sbjct : 3930889 MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAVKRYPQRPLSLYVHIP 3930710 ...

Еще в разделе: (Показать все результаты (>39435) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~smivic/Projects/Term_3/Downloads/gluq_pm_n.blast
• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• http://kodomo.fbb.msu.ru/~element/Term3/search_3T.txt

This page is devoted to information on Supernova 1999dq in NGC 976 Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main supernova page. Information on the original web pages for many of these images can be found on the Supernova links web page. Supernova 1999dq is the 24th LOSS discovery this year. ... VSNET Light curve (requires JAVA). ... vsnet-alert 3442 ] SNe 1999dp and 1999dq . vsnet-chat 2285 ] Host galaxy of SN1999dq . ...

Еще в разделе: (Показать все результаты (>437) - www.rochesterastronomy.org/ )

• Supernova 1999ee and 1999ex in IC 5179
• Supernova 1999ev in NGC 4274
• Supernova 1999ej in NGC 495

... The RFC Editor makes a brief report to the plenary of each IETF meeting. ... RFC Editor Report at IETF 90 , Toronto, Canada . ... RFC Editor Report at IETF 88 , Vancouver, Canada . ... RFC Editor Report at IETF 86 , Orlando, FL, United States . RFC Editor Report at IETF 85 , Atlanta, GA, United States . ... RFC Editor Report at IETF 81 , Quebec City, Canada . ... RFC Editor Report at IETF 74 , San Francisco, CA, United States . ... RFC Editor Report at IETF 67 , San Diego, CA, United States . ...

Еще в разделе: (Показать все результаты (>20555) - mirror.msu.net/ )

Note: there are 3 CIS id's for reporting problems listed at the end of this file. ... Can you recreate the problem? ... CSD Level: _______ OS/2 Version 2.0 GRE.. ... Port Used : ________________ Printer is attached to: Local _ LAN Server _ Host _ COMMUNICATIONS MANAGER - If this is a problem with Communications Manager, please provide answers in this section: OS/2 Extended Services .. ... CSD Level: ________ OS/2 LAN Server 2.0 Advanced: _ CSD Level: ________ LAN REQUESTER: LAN Server 2.0 Requester.. ...

Еще в разделе: (Показать все результаты (>9362) - crydee.sai.msu.ru/ )

• Bug Reports for This Document
• Album: Reports from various events

... Submitting bug reports . Up: Problems Next: Problems configuring Previous: Problems . Any problem that you can't solve by checking this section should be sent to mpi-bugs@mcs.anl.gov . ... If the problem is with a script like configure or mpirun, run the script with the -echo argument (e.g., mpirun -echo -np 4 a.out ) . ... If you have more than one problem, please send them in separate messages; this simplifies our handling of problem reports. ... Центры . ...

Еще в разделе: (Показать все результаты (>608) - www.parallel.ru/ )

• TOP500 Supercomputer Sites
• Problems | PARALLEL.RU - Информационно-аналитический центр по параллельным

SVETKA, a program for Analysis of Multiple Sequence Alignments . ... T his is a database of some analysed "model" alignments. These sets of amino acid sequences were taken from COGs database . ... Results of the analysis of "model" alignments are acceptable from the table below. Every alignment is called VAL xxxx , where xxxx is the number of the original COG (e.g. VAL1188 is obtained from COG1188 ). Alignment name . ... of sequences . Alignment length . Alignment quality . ...

Еще в разделе: (Показать все результаты (>6536) - monkey.belozersky.msu.ru/ )

• About COGs
• Molecular biology databases
• SDPpred

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: haute reporters to Cartier established en . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>3903) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Reported that imports often
• Экологический Форум - Фундаментальная Экология: enterprises reported: Tiffany
• Экологический Форум - Фундаментальная Экология: Consumer Reports

... О физическом факультете . ... Помощь факультету . ССО факультета . ... Система электронного документооборота (СЭД) МГУ . Удаленный доступ к информационным ресурсам физфака . ... Физический факультет . ... Наш факультет . Новости факультета . ... Журнал "Вестник МГУ. Физика, Астрономия" . Журнал "Ученые записки физич. факультета МГУ" . Онлайн доступ к научным журналам и книгам . ... Публикации . ... Журнал "Ученые записки физического факультета МГУ" . ... Список учебных курсов . ...

Еще в разделе: (Показать все результаты (>167) - phys.msu.ru/ )