... The Sea of Tranquillity: 5 Seconds To Impact . ... Credit: NASA Explanation: On February 20th, 1965, the Ranger 8 spacecraft crashed into the Moon . ... Two kilometers across, with 4 meter sized objects visible, the picture is of an area in the Sea of Tranquillity north of the Apollo 11 landing site. ... Publications with keywords: impact - Ranger program - spacecraft - Ranger 8 - Moon . Publications with words: impact - Ranger program - spacecraft - Ranger 8 - Moon . ...

Еще в разделе: (Показать все результаты (>75784) - www.astronet.ru/ )

• Астронет > The Sea of Tranquillity: 5 Seconds To Impact
• Moon Crashers
• Journal "Peremennye Zvezdy"

... July 30, 1999 . The Sea of Tranquillity: 5 Seconds To Impact . Credit: NASA . ... Rapidly transmitting a series of pictures to ground controllers, its camera recorded this one at an altitude of about 11 kilometers, 5 seconds before impacting the lunar surface. ... Its very successful mission in lunar orbit complete, the Lunar Prospector is scheduled to crash into a crater near the Moon's south pole in an effort to confirm the presence of water-ice by studying the impact's debris cloud. ...

Еще в разделе: (Показать все результаты (>9900) - www.sai.msu.su/ )

• APOD: 2005 February 3 - SMART 1: Pythagoras Crater
• APOD: February 3, 1996 - A Huge Impact Crater on Mars
• APOD: 2005 February 9 - Heat Shield Impact Crater on Mars

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Methodology of stereoscopic motion picture quality assessment . ... Conference Paper . ... Conference Name . Stereoscopic Displays and Applications XXIV, Proc. of SPIE-IS&T Electronic Imaging, SPIE . ... http://compression.ru/video/vqmt3d/papers/Methodology%20for%20Stereoscopic%20Motion-picture%20Quality%20Assessment.pdf . ...

Еще в разделе: (Показать все результаты (>888) - graphics.cs.msu.ru/ )

• Publications | Graphics and Media Lab
• Removing of blocking effect from video | Graphics and Media Lab
• Smart removal of blocking effects from video | Graphics and Media Lab

Dear alumni, . IREX is pleased to announce the February round of 2005 Alumni Small Grants Competition. ... The ECA Alumni Small Grants Program was piloted by IREX in February 1999. ... The purpose of the ECA Alumni Small Grants Program is to further the professional development of ECA alumni. ... We encourage you to contact your local IREX office with any questions and to check whether they will be holding an informational workshop for the Alumni Small Grants Program in the near future. ...

Еще в разделе: (Показать все результаты (>191) - www.prof.msu.ru/ )

• ECA Alumni Small Grants Program
• Conferences & Publications

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>183) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. February 5, 1996 . COBE Dipole: Speeding Through the Universe . Credit: NASA , COBE , DMR , Four-Year Sky Map . ... The Milky Way Galaxy orbits in the Local Group . ... The map indicates that the Local Group moves at about 600 kilometers per second relative to this primordial radiation . ... About APOD | ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 February 13 - Southwest Mercury
• APOD: February 21, 1996 - Millions of Stars in Omega Centauri
• APOD: February 3, 1998 - A Magellanic Mural

This example shows how to make, store to file, and read a picture as a set of drawing commands. ... This example ** program may be used, distributed and modified without limitation. ** *****************************************************************************/ # include ctype.h # include qapplication.h # include qpainter.h # include qpicture.h # include qpixmap.h # include qwidget.h # include qmessagebox.h # include qfile.h void paintCar( QPainter *p ) // ...

Еще в разделе: (Показать все результаты (>651) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - Example Programs

... Space Science Education . ... Porn Tube Best Site free sex pictures mature , [url=http://www.threadless.com/profile/1063144/freesexpicturesmature]free sex pictures mature[/url] , http://www.threadless.com/profile/1063144/freesexpicturesmature - free sex pictures mature , miley cyrus nude pictures , [url=http://forums.quark.com/members/mileycyrusnudepictures.aspx]miley cyrus nude pictures[/url] , http://forums.quark.com/members/mileycyrusnudepictures.aspx - miley cyrus nude pictures , . ...

Еще в разделе: (Показать все результаты (>6715) - cosmos.msu.ru/ )

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>47) - cdfe.sinp.msu.ru/ )

... 1984: Department of Structural and Applied Linguistics, Philological Faculty, Moscow State University; M.A. earned in June 1984. ... 2003, Habilitation report: Analiz diskursa v kognitivnoj perspektive (Discourse analysis in a cognitive perspective) [ pdf ]. Institute of Linguistics RAN. 90 pp.. ... Cognitive Lingustics Association (since 1997). ... Cognitive Linguistics (Berlin, Mouton de Gruyter), 1997 ? ... Popularization of the advances in linguistics and cognitive science on Russian TV. ...

Еще в разделе: (Показать все результаты (>383) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/research_interests...
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/teaching.html
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/index.html

Use of humates to remediate polluted environments: . ... Picture gallery of the events . ... Interaction of humic substances with metal ions and its implication for remediation of heavy metals polluted environments . Chairperson: Prof. Frimmel . ... Coffee break . ... Influence of metal ions on the activity of soil humics-enzyme complexes. ... Frimmel, F.H. Influence of oxidation on the metal-ion complexation of NOM with respect to remediation. ... Hatfield, K. Quantifying remediation. ...

Еще в разделе: (Показать все результаты (>183) - mgumus.chem.msu.ru/ )

• MGUMUS -- Second International Conference of CIS IHSS on Humic Innovative
• MGUMUS -- Tatiana A. Sorkina

... I was born on February 15, 1971 in Moscow (Russia). From 1988 to 1994 I was a student of the Faculty of Physics of Moscow State University . From 1994 to 1997 I was a Post-graduate student of the Faculty of Physics of Moscow State University . From 1997 I am working for the Division of Theoretical High Energy Physics of the Skobeltsyn Institute of Nuclear Physics of Moscow State University as a scientific collaborator. ... QFTHEP'2001 (Moscow) . ... with my cat Piso . my cat Piso . ...

Еще в разделе: (Показать все результаты (>3461) - theory.sinp.msu.ru/ )

• Pictures
• LanHEP

... LP-Moon.pdf - 26KB . ... A. A. Berezhnoy1,2, N. Hasebe1, M. Kobayashi1, G. Michael3 and N. Yamashita1 1Advanced Research Institute for Science and Engineering, Waseda University, Tokyo, Japan 2Sternberg Astronomical Institute, Moscow, Russia 3German Aerospace Center, Institute for planetary research, Berlin, Germany . Brown University - Vernadsky Institute Microsymposium 40, 2004, Moscow, Russia . ... 3Now at: Sternberg Astronomical Institute, Moscow University, Moscow, Russia . ...

Еще в разделе: (Показать все результаты (>136) - selena.sai.msu.ru/ )

• Ekaterina A. Kozlova
• Бережной А.А.
• List of publications

.

Еще в разделе: (Показать все результаты (>541) - xray.sai.msu.ru/ )

• Astronomical Periodical Publications
• Astronomical Resources
• Sergei Popov

... Sections . ... Atlas "Birds of Moscow City" . ... The 'Birds of Moscow and the Moscow Region' project operates in the Zoological Museum of Moscow State University since 1999. ... Atlas "Birds of Moscow City" Monitoring of common birds Breeding bird atlas of European Russia Birds of Moscow and the Moscow Region Photo-guide of birds of European Russia Invertebrate Zoology Entomology Ichthyology Herpetology Ornithology Mammalogy Evolutionary Morphology History of museum Collections For public visitors ...

Еще в разделе: (Показать все результаты (>1382) - zmmu.msu.ru/ )

... Science . ... lrm@cs.msu.su . ... The Laboratory of Difference Methods was founded by A.A.Samarsky, Academician of RAS, in the middle of the 60s. For more than 50 years the Laboratory?s theoretical research has been focused on numerical methods for problems described by systems of partial differential equations. ... N.V.Ardelyan, V.L.Bychkov, I.V.Kochetov and K.V.Kosmachevskii, Non-self-maintained discharge plasma in propane-air mixture // IEEE Trans. on Plasma Science, vol. 39. no. 12, part 1, pp. ...

Еще в разделе: (Показать все результаты (>254) - en.cs.msu.ru/ )

• International Scientific Conference "Probability Theory and its Applications"
• Department of Supercomputers and Quantum Informatics | CMC MSU
• International project INARM of EU program Tempus-IV | CMC MSU

.

Еще в разделе: (Показать все результаты (>212) - comet.sai.msu.ru/ )

• Washington 2002 + few El Paso pictures
• V.F. Esipov Home Page
• Pictures of Crimea

... WINDOW, 0 plot, title='sum of rows', suma ;!!! function for finding mouse position !!! i=0 n=INTARR(3) !mouse.button=1 WHILE(!MOUSE.BUTTON NE 4) DO BEGIN CURSOR,X1,Y1,/DATA,/DOWN IF !MOUSE.BUTTON EQ 1 THEN $ PRINT ,FORMAT='( POSITION =[ ,I10.0, , ,F10.2, ] )',X1,Y1 ;,Q[X,Y] n[i]=x1;use only x coordinate of the position i=i+1 endwhile nit1=n[0] ; the position of the first hair nit2=n[1] ; the position of the ...

Еще в разделе: (Показать все результаты (>449) - lnfm1.sai.msu.ru/ )

• http://lnfm1.sai.msu.ru/~kupry/SOFTWARE/poluautomatski.pro
• IDL programs
• Multichannel Flare Spectrograph

... List of Publications . ... L.N. Rashkovich, A.S. Filonov, and I.V. Yaminsky, Shape of Steps on the (010) Face of Orthorhombic Lysozyme Crystals - Crystallography Reports, 2008, 53(2), 320-325. ... I.V. Yaminsky, A.S. Filonov, A.V. Bolshakova, N.I. Nikonorova, Local Properties Study of Nanostructured Materials via Internet Probe Microscopy // Lomonosov Conference 2007, Moscow, April, 2007, Conference Proceedings . ... E.V. Dubrovin, A.S. Filonov, G.B. Meshkov, O.V. Sinitsyna, I.V. Yaminsky. ...

Еще в разделе: (Показать все результаты (>128) - www.spm.genebee.msu.ru/ )

• Evgeny Menshikov
• FemtoScan Online program
• Change in inner data representation

Электронная библиотека Попечительского совета . ... Huang T.S., Andrews H.C. - Picture Processing and Digital Filtering . ... Название: Picture Processing and Digital Filtering . Авторы: Huang T.S., Andrews H.C. Аннотация: . ... We hope that in-depth treatments of some of the important recent results in picture processing and digital filtering will appear in future volumes of the Springer physics program. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>14096) - lib.mexmat.ru/ )

• Greenberg A. - From Alchemy to Chemistry in Picture and Story :: Электронная
• Streater R.S., Wightman A.S. - PCT, Spin and Statistics, and All That ::
• Поиск книг, содержащих picture (окружение) :: Электронная библиотека