1. Eris: The Largest Known Dwarf Planet
... 18.09.2006 . ... Credit: W. M. Keck Observatory Explanation: Is Pluto the largest dwarf planet? ... Currently, the largest known dwarf planet is (136199) Eris , renamed last week from 2003 UB313 . Eris is just slightly larger than Pluto, but orbits as far as twice Pluto 's distance from the Sun. ... Dwarf planets Pluto and Eris are trans-Neptunian objects that orbit in the Kuiper belt of objects past Neptune. ... September 2006 . ... NASA Web Site Statements, Warnings, and Disclaimers . ...
[
]
http://www.astronet.ru/db/xware/msg/1216382 -- 14.0 -- 19.09.2006
:
(
(>34189) - www.astronet.ru/ )
2. APOD: 2006 September 18 - Eris: The Largest Known Dwarf Planet
... 2006 September 18 . Eris: The Largest Known Dwarf Planet . ... Explanation: Is Pluto the largest dwarf planet? ... Currently, the largest known dwarf planet is (136199) Eris , renamed last week from 2003 UB313 . ... Dwarf planets Pluto and Eris are trans-Neptunian objects that orbit in the Kuiper belt of objects past Neptune. ... Since Pluto's recent demotion by the IAU from planet to dwarf planet status, Pluto has recently also been given a new numeric designation: (134340) Pluto. ...
[
]
http://www.sai.msu.su/apod/ap060918.html -- 5.5 -- 02.10.2012
:
(
(>6743) - www.sai.msu.su/ )
3. APOD: 2000 September 25 - AR 9169: A Large Sunspot
... 2000 September 25 . AR 9169: A Large Sunspot . ... Explanation: One of the largest sunspots in recent years is now crossing our Sun . Dominating active region AR 9169 , the sunspot is the large dark complex visible below (west) and right of center in the above photograph of our Sun taken last Thursday. ... AR 9169 holds the largest sunspot yet produced during this Solar Maximum , the time of greatest sunspot activity during the Sun's 11-year magnetic cycle . ... About APOD | ...
[
]
http://www.sai.msu.su/apod/ap000925.html -- 4.8 -- 01.10.2012
:
(
(>91) - www.arcetri.astro.it/ )
4. Simiano M. - Experimental Investigation of Large-Scale Three Dimensional Bubble
. ... Simiano M. - Experimental Investigation of Large-Scale Three Dimensional Bubble Plume Dynamics . ... : Experimental Investigation of Large-Scale Three Dimensional Bubble Plume Dynamics . : Simiano M. : . ... This allowed sampling and ensemble averaging of according to the bubble plume position or bubble plume diameter. The three dimensional plume dynamics was intensively investigated. ...
[
]
http://lib.mexmat.ru/books/13336 -- 18.2 -- 10.04.2016
:
(
(>11057) - lib.mexmat.ru/ )
5. Photo album: Japan: Kyoto and Nara, August 1997
... Day-by-day lines contain complete set and intended for those who have been there (I mean, in Kyoto :) . ... Large format is mainly for 1600x1200 screens and fast link (pictures are up to 150K in size). Normal is for typical 1024x768 screen (i.e. 15" monitors). ... Photos look incredible on it. ... Large . ... Normal . ... Thumbnails . ... Contents with thumbnails: Large | ... Nara, one of the historical cities of Japan . ... August 17, Sunday. ... Nara. ... return to photo album contents | ...
[
]
http://crydee.sai.msu.ru/photo/japan/ -- 9.3 -- 10.05.1998
:
(
(>5836) - crydee.sai.msu.ru/ )
6. "A new technology of aperture shadowing calculation for a large space radio
A new technology of aperture shadowing calculation for a large space radio telescope mirror" . Bujakas V.I. A new technology of aperture shadowing calculation for large space radio telescope mirror is proposed in the framework of geometrical optics. The technology exploits the possibilities of Solid Works package and is applied for the aperture shadowing calculation of a plane wave and for the total aperture shadowing of the 10-meter mirror of the space telescope "Radioastron". ...
[
]
http://num-meth.srcc.msu.ru/english/zhurnal/tom_2008/v9r128.html -- 2.8 -- 12.09.2008
:
(
(>207) - num-meth.srcc.msu.ru/ )
7. Large Layered Intrusions
... Publications :: Large Layered Intrusions . ... Chalokwu C.I., Ariskin A.A., Koptev-Dvornikov E.V. (1996) Forward modeling of the incompatible element enrichment at the base of the Partridge River intrusion, Duluth Complex, Minnesota: Magma dynamics in a lower mushy zone. ... Krivolutskaya N.A., Ariskin A.A., Sluzhenikin S.F., Turovtsev D.M. Geochemical Thermometry of Rocks of the Talnakh Intrusion: Assessment of the Melt Composition and the Crystallinity of the Parental Magma. ... read >>] . ... Vol...
[
]
http://geo.web.ru/~ariskin/objects.html?id=intrusions&ln=69 -- 8.6 -- 22.12.2007
:
(
(>1189) - geo.web.ru/ )
8. http://selena.sai.msu.ru/Chik/Publications/Aitken/MS015.pdf
Microsymposium 34, MS015, 2001 TO THE DISCOVERY OF THE "SOUTH POLE - AITKEN " BASIN. ... Head [2] and Spudis [1] suggested in their reviews that the existense of the structure identified later as the South Pole - Aitken baasin was first predicted on the basis of a relief analysis of the mountain ridges observed in the libration zone be Hartman and Kuiper [7], i.e. after the first images of the lunar far-side had been obtained. ... SOUTH POLE-AIKEN BASIN: V.I.Chikmachev et al. ...
[
]
http://selena.sai.msu.ru/Chik/Publications/Aitken/MS015.pdf -- 398.5 -- 06.10.2008
:
(
(>119) - selena.sai.msu.ru/ )
9. LARGE
... Prev . Next . ... , #NUM!. @k <= 0 @k , #NUM!. Excel. ... A5 11.4, 17.3, 21.3, 25.9 40.1. . ...
[
]
http://uneex.mithril.cs.msu.su/static/GnumericDoc_ru/r5694.html -- 4.1 -- 26.09.2011
[
]
http://uneex.lorien.cs.msu.su/static/GnumericDoc_ru/r5694.html -- 4.1 -- 26.09.2011
:
(
(>227) - uneex.lorien.cs.msu.su/ )
10. Firefly/PC GAMESS DOCUMENTATION - LARGE SCALE MCQDPT2 and XMCQDPT2
The main purpose of the new MCQDPT2 code is to speed up calculations in the cases of medium to large basis sets and medium to large active spaces using resolvent fitting (aka table-driven) approach. ... In the latter cases it is recommended to use the default PC GAMESS/Firefly' MCQDPT2 code. ... P2P Parallel Mode Communication Interface, Dynamic Load Balancing, and large-scale MP2 Energy code . New MP2 gradient code documentation . PC GAMESS/Firefly' NBO code . ...
[
]
http://classic.chem.msu.su/gran/gamess/mcqdpt2.html -- 4.9 -- 15.02.2010
:
(
(>89) - classic.chem.msu.su/ )
11. > A large IT company is looking for J2EE
... : A large IT company is looking for J2EE Developer . > > . ... Design, coding, testing, implementation and production support of enterprise-level J2EE applications; Business analysis, discovery, and technical specification development; J2EE cross-training activities; career- and goal-oriented; . ...
[
]
http://wasp.phys.msu.ru/forum/lofiversion/index.php?t7522.html -- 4.5 -- 11.04.2016
:
(
(>912) - wasp.phys.msu.ru/ )
12. - : term, Tiffany to large that
... . .. . . .. . . ... - : . : term, Tiffany to large that expensive. re . ... -- -- " " - - . ...
[
]
http://www.sevin.ru/fundecology/forum/forum_posts.asp?TID=5128&PN=1220 -- 20.3 -- 01.03.2014
:
(
(>4176) - www.sevin.ru/ )
13. [RU-NGI] Fwd: Re: [www.dcache.org #7066] recomendations for large dCache
... Previous message: [RU-NGI] CMS pilots . Next message: [RU-NGI] Fwd: Re: [www.dcache.org #7066] recomendations for large dCache installations . ... on 30.03.2012 20:32, Paul Millar via RT wrote: > > Hi Victor, > > I've placed a document with the recommendations here: > > https://discordia.desy.de/paul/Blueprint/blueprint.pdf > > Please let me know if you have any problems fetching the file or if there's anything unclear or that should be improved in the document. Cheers, > > Paul. ...
[
]
http://theory.sinp.msu.ru/pipermail/ru-ngi/2012q2/000491.html -- 5.6 -- 03.04.2012
:
(
(>622) - theory.sinp.msu.ru/ )
14. Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR - Public forum
. Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . : 1 | (7) . Angren : Re: Avantasia [re:Deathstar] 18.01.2008 01:34 | Reply | Edit | . 1 . Genius. : Chris Boltendahl (Grave Digger), Oliver Hartmann (ex-At Vance), Russell Allen (Symphony X, Ayreon), Edu Falaschi (Angra), Liv Kristine (Leaves' Eyes), DC Cooper (Shadow Gallery, Silent Force) . Top .
[
]
http://www.fds-net.ru/showflat.php?Number=7103544&src=&showlite=l -- 3.9 -- 28.02.2014
:
(
(>3256) - www.fds-net.ru/ )
15. Accretion Mechanizsm of the Formation of the Large Structure
"Dynamical friction and formation of structures: some cosmological aspects", Astroph. Space Sci., v.123, p.393-402, 1986 (with S.G.Simakov). "Accretion Mechanism of the Formation of Large Scale Structure of the Universe", Astron.Zh., vol.66, p225-231, 1989 (with S.G.Simakov). Back .
[
]
http://xray.sai.msu.ru/~lipunov/simakov.html -- 1.7 -- 16.06.2000
:
(
(>467) - xray.sai.msu.ru/ )
16. http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...
[
]
http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta -- 9.5 -- 20.04.2009
[
]
http://kodomo.cmm.msu.ru/~marine/kodomo.txt -- 9.4 -- 26.04.2009
:
(
(>1362) - kodomo.cmm.msu.ru/ )
17. Wanda at Large - - Kinfo.ru
. [ ] . -> -> Wanda at Large . . . . . . Wanda at Large . 2003 . . . .
[
]
http://kinfo.ru/Movie/f656e55a-bbff-406a-b09c-00248ff6cb71 -- 7.1 -- 11.04.2016
:
(
(>1362) - kinfo.ru/ )
18. Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR - Public forum
... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...
[
]
http://www.snto-msu.net/showflat.php?Number=7085979&src=&showlite= -- 46.9 -- 10.04.2016
:
(
(>1722) - www.snto-msu.net/ )
19. Large transportation networks with finite-dimensional state space. Asimptotic
... Moscow Lomonosov State University . ... Consider an open network consisting of N nodes (stations) and V(N) cars, which circulate among the stations. The network is divided into n clusters. ... Cluster j contains d N j N stations, j = 1 n d N j = 1. ... Later j and v denote cluster numbers and they take values from 1 to n. The arrival process to a station of cluster j is a Poisson one with the rate l j . ... The destination station in the cluster v is chosen uniformly. ...
[
]
http://www.philol.msu.ru/~lex/khmelev/proceedings/vilnus1998.html -- 12.7 -- 28.02.2014
[
]
http://old.philol.msu.ru/~lex/khmelev/proceedings/vilnus1998.html -- 12.7 -- 10.04.2016
:
(
(>56) - old.philol.msu.ru/ )
20. Electric probe detection of large cluster ions in spinodal decomposition of the
. Kudryashov S.I. , Zorov N.B. Mendeleev Communications, p. 178 (1998). Abstract . The electric probe procedure developed here has made it possible to detect for the first time large cluster ions, the products of spinodal decomposition of the laser-induced labile state of the liquid phase of carbon, with a size up to a million atoms and relative content in the mass distribution of the order of ppm. Laboratory of Laser Diagnostics
[
]
http://www.chem.msu.ru/eng/publ/r99-062.html -- 1.8 -- 27.02.2014
[
]
http://chem.msu.ru/eng/publ/r99-062.html -- 1.8 -- 09.04.2016
:
(
(>371) - chem.msu.ru/ )