... The Great Nebula in Carina . ... Eta Carinae , the most energetic star in the nebula, was one of the brightest stars in the sky in the 1830s, but then faded dramatically. Eta Carinae is the brightest star near the image center, just left of the Keyhole Nebula . While Eta Carinae itself maybe on the verge of a supernova explosion, X-ray images indicate that much of the Great Carina Nebula has been a veritable supernova factory . Tomorrow's picture: open space . ...

Еще в разделе: (Показать все результаты (>11915) - www.sai.msu.su/ )

• APOD: 2007 June 2 - 3D Full Moon
• APOD: 2004 March 25 - An Orion of a Different Color
• APOD: 2001 June 16 - APOD is Six Years Old Today

... An Orion of a Different Color . ... It is a familiar object though, the grand stellar nursery known as the Orion Nebula . But the striking picture combines images taken through three separate filters, each designed to record different emission lines - light from Sulfur, Oxygen, and Hydrogen atoms glowing in the tenuous nebular gas. At such low densities , Sulfur and Hydrogen atoms emit red colors while Oxygen glows green. ... Publications with keywords: Orion Nebula . ... The Heart Of Orion . ...

Еще в разделе: (Показать все результаты (>75401) - www.astronet.ru/ )

• Mars: Big Crater in Stereo
• PG 1115+080: A Gravitational Cloverleaf
• Geminids in 2007

... October 4, 1995 . The Sun Spews X-rays . Credit: Yohkoh Soft X-ray Telescope , ISAS , Japan . Explanation: Our Sun is really very hot. The Sun's outer atmosphere is so hot that it emits much light in the X-ray band, which was unexpected. X-rays are usually emitted from objects having a temperature in the millions of degrees, not the mere thousands of degrees of the Sun's surface. The above X-ray picture shows the Sun one particularly active day in August of 1992. ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: May 5, 1998 - Aurora at Midnight
• APOD: December 17, 1996 - Mariner's Mercury
• APOD: 2000 October 15 - Globular Cluster Omega Centauri

... Alliance-3.0 (EDA/VLSI design tools) (by Christoph Jaeschke , probably requires LessTif ) . ... 01oct98) Nedit 5.0.2 editor , (by Alexander Mai , see also version 5.01 , by Greg Kondrasuk , requires LessTif ) . ... 28jan98) XMGR plotting software (by Alexander Mai ) . ... 28jan98) Nedit 5.01 (by Alexander Mai , requires LessTif ) . ... 07apr98) XDIR 2.1 , File mgr and ftp (by Alexander Mai , requires LessTif ) . 28jan98) XFTP 2.1 (by Alexander Mai , requires LessTif ) . ...

Еще в разделе: (Показать все результаты (>7199) - crydee.sai.msu.ru/ )

Электронная библиотека Попечительского совета . ... Purcell J., Tavella D. - Dialogue Editing for Motion Pictures: A Guide to the Invisible Art . ... Название: Dialogue Editing for Motion Pictures: A Guide to the Invisible Art . Авторы: Purcell J., Tavella D. Аннотация: . Dialogue editing is a crucial yet invisible part of filmmaking. ... How a film was shot, recorded and edited will dramatically influence the dialogue editing process. ...

Еще в разделе: (Показать все результаты (>12261) - lib.mexmat.ru/ )

• Nai-Phuan Ong (Editor), Bhatt R. (Editor) - More is Different: Fifty Years of
• Meire P. (Editor), Coenen M. (Editor), Lombardo C. (Editor) - Integrated Water
• Long B. - Getting Started with Camera Raw: How to make better pictures using

. The HTMLPAGE uses the client-side imagemap construction.Click the any picture to see full-size and full-color images. If your client don't support client-side imagemap, You can append the filename (under each image) to the URL location Description: . Not available yet ... Best Regards, Pavel Plechov

Еще в разделе: (Показать все результаты (>704) - geo.web.ru/ )

• Index of Kamchatka Pictures

The vi editor (pronounced "vee eye") is available on all UNIX systems: other editors are not. Being able to use vi ensures that you will always have an editor available to you. ... About vi commands . Using UNIX commands . Starting vi and opening files . Saving files and exiting vi . Viewing a file . Entering text . Cutting and pasting text . Moving around the text . Moving around the screen . Deleting text . Searching for text . Replacing text . ...

Еще в разделе: (Показать все результаты (>315) - comet.sai.msu.ru/ )

• Remote telescopes
• Pathnames
• Commands available in send mode

Use of humates to remediate polluted environments: . ... Picture gallery of the events . ... Use of different adsorbents (peats, sapropels, ceolites) in remediation technologies . ... Bezuglova, O.S. Use of humates and humate-enzyme complexes for the detoxification of soils contaminated with heavy metals. ... Coffee break . 11:00-12:00 . ... Theory and practice of humates use for remediation of polluted environments . ... Round table discussion: Working groups . ...

Еще в разделе: (Показать все результаты (>156) - mgumus.chem.msu.ru/ )

• Picture gallery of the participants and guests
• Humates NATO ARW Home Page

Here are some of the example programs that are included with Qt: . aclock/aclock.cpp . application/application.cpp . ... mainlyMotif/editor.cpp . mainlyQt/editor.cpp . mainlyXt/editor.cpp . ... These paths are relative to the examples subdirectory in the Qt distribution. ... Copyright © 1998 Troll Tech . ... Qt version 1.40 ...

Еще в разделе: (Показать все результаты (>546) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - picture/picture.cpp example file
• Pictures of Most Widgets
• Using the CG-editor

Norwegian Libraries: . ... ARLIS - Kunstbib: Norwegian Art History Bibliography. ... The Norwegian Museum of Architecture . ... Art Museums . ... Henie-Onstad Art Center - Hovikodden: Norway's first Museum of Fine Arts on Internet. The Astrup Fearnley Museum of Modern Art . ... National Museum of American Art . Dallas Museum of Art . ... Electra '96 Henie Onstad Art Center's Project for Electronic Media. ... WWW-Library: History of Art . ... News: rec.fine.arts . ... News: k12.ed.art . ...

Еще в разделе: (Показать все результаты (>8) - www.hist.msu.ru/ )

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: give the motion picture to a considerably . ... Are you presently now contemplating about getting a few of designer <a href=http://www.discountedsunglassesonline.net/#201>cheap oakley flak jacket xlj sunglasses</a> sunglasses? ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>6549) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: give the motion picture to the
• Экологический Форум - Фундаментальная Экология: provide the motion picture to
• Экологический Форум - Фундаментальная Экология: I may have some pictures to...

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>140) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• TreeTop - Phylogenetic Tree prediction

FITShdr' package contains set of utilities, that allows to display or modify FITS-file headers (FITS MEF included). ... Both source tarball (see INSTALL ) and i386 RPM are available for downloading: fitshdr-current.tar.gz size: 36379 MD5 checksum: 1e7222149ca36696797a6e0f4af41afc SHA1 checksum: 990bdf69f67d2b989d2d6e044deeaf9128d4470c fitshdr-1.0.6-1.i386.rpm size: 539101 MD5 checksum: 19e046da52b3ec8dd89aaed9e806bb5d SHA1 checksum: 07a4b4e2bd96a4c9fda7dc65127d0b80130c97e1 ...

Еще в разделе: (Показать все результаты (>206) - lnfm1.sai.msu.ru/ )

• Anatoly V. Zasov
• ...Some useful software links...

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... TextEditor 2 - 2004-08-15 - PeterThoeny . Line: 1 to 1 . A text editor, or text processor, handles plain text only, different from a word processor because it doesn't do display formatting like bold type, or mixed font styles, sizes and colors. ... TWiki:Main.MikeMannix - 12 May 2002 . ... HTML editors are text editors with built-in formatting functions. ...

Еще в разделе: (Показать все результаты (>37193) - dualopt1.cmm.msu.ru/ )

• TextEditor - TWiki - TWiki
• TextEditor - TWiki - TWiki - (printable)
• %TOPICTITLE% (2 vs. 3) - TWiki

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>61) - brain.bio.msu.ru/ )

• Other prospects of the change-point based analysis

Calendars Order images | ... Calendars . ... We collect our best pictures for calendars sets. ... Volcanoes of Kamchatka . Best shots of Kamchatka's volcanoes. ... Volcanoes at winter. ... Kamchatka . Fastination landscapes of famous kamchatka's Gaiser's Valley. ... Kamchatka: volcanoes, sea and ice . 13 best shots of different Kamchatka's landscapes - sea cost, icebergs, frosen sea, storming sea, volcanoes. ... Orders can be made via e-mail, or post. ... EcoPhoto Imagery . ...

Еще в разделе: (Показать все результаты (>560) - www.fadr.msu.ru/ )

• "EcoPhoto" - Collection - Order photo

... 2015 . ... Submit your article . ... Graduate student, School of Public Administration, Lomonosov Moscow State University, Moscow, Russian Federation. ... The article provides a detailed picture of the modern view of the mechanism of public sector entrepreneurship. ... Realization of these components of the mechanism of public sector entrepreneurship changes the traditional view of inefficiency of state-owned business and brings SOEs to a new level of development. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>568) - ee-journal.spa.msu.ru/ )

... IETF 68 RFC Editor 2 News ! ... Replaced by draft- ietf -v6ops-natpt-to-historic 160 Few (166) 26 Moderate draft- ietf -v6opsnatpt-to-exprmntl02 IETF 68 RFC Editor 12 Monthly RFC Editor Statistics Feb 2007 * Total Submitted [New Arrivals: Standards Track] - Jan 2007 43 17 2 12 11 24 10 0 4 0 6 1 2 1 137 Dec 2006 11 15 0 5 1 22 13 0 0 0 2 0 7 0 119 Nov 2006 22 12 3 4 3 34 16 0 2 0 7 0 9 0 130 Oct 2006 33 11 8 7 7 41 17 0 5 0 8 0 11 0 142 Sep ... IETF 68 RFC Editor 16 ...

Еще в разделе: (Показать все результаты (>19505) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/IETFreports/2003/jul03-report.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/IETFreports/2009/ietf75.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc7101.txt.pdf

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Methodology of stereoscopic motion picture quality assessment . ... Conference Paper . ... Conference Name . Stereoscopic Displays and Applications XXIV, Proc. of SPIE-IS&T Electronic Imaging, SPIE . ... http://compression.ru/video/vqmt3d/papers/Methodology%20for%20Stereoscopic%20Motion-picture%20Quality%20Assessment.pdf . ...

Еще в разделе: (Показать все результаты (>228) - graphics.cs.msu.ru/ )

• Methodology of stereoscopic motion picture quality assessment | Лаборатория
• Convergence of Computer Graphics and Machine Vision (From the Editor of the
• Removal of comb effect from video | Graphics and Media Lab

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Miscellaneous Documentation . ... This page documents all the relevant standards that the Apache HTTP Server follows, along with brief descriptions. ... http://www.rfc-editor.org/errata.html - RFC Errata . ... This document summarizes the history of HTML development, and defines the "text/html" MIME type by pointing to the relevant W3C recommendations. ... HTML documents are SGML documents. ...

Еще в разделе: (Показать все результаты (>541) - itpm.msu.su/ )

• Hard disks
• Multi-Processing Modules (MPMs) - Apache HTTP Server
• perchild - Apache HTTP Server