... All rights reserved finmen.spa@mail.ru : : hcp://spa.msu.ru/page_325.html : hcp://vk.com/mh_msu_fgu_finance .. ... All rights reserved / () · : · : LIBOR ( London Interbank Offered Pate), MIBOR ( Moscow Interbank Offered Pate) · :LIBID (London Interbank Bid), MIBID (Moscow Interbank Bid) · : MIACR (Moscow Interbank Ac·al Credit Rate) · : Prime- rate, Mosprime- rate .. ... All rights reserved · ­ , t i B ­ D =- - - - - - - - - - - - - - t - 360 i - , 100% · .. ... All rights reserved · , · APR ­ , . ...

Еще в разделе: (Показать все результаты (>1056) - www.spa.msu.ru/ )

• http://www.spa.msu.ru/uploads/files/bakalavriat/lecture_2702_finance_analysis.pdf
• http://www.spa.msu.ru/uploads/files/bakalavriat/lecture_2002_finance_analysis.pdf

Планеты во Вселенной . Курс лекций для студентов астрономического отделения . Есть ли основания полагать, что планеты являются распространенным явлением во Вселенной? Может ли служить наша Солнечная система типичным примером или она уникальна? ... Эта странная Солнечная система . ... Так рождаются планеты? ... Отдела исследований Луны и планет: . ... к.ф.м.н. Ж.Ф.Родионова . к.ф.м.н. В.В.Бусарев . ... Карты Меркурия Ж.Ф.Родионова . ... Карты Луны Ж.Ф.Родионова . ... Луны и планет . ...

Еще в разделе: (Показать все результаты (>167) - selena.sai.msu.ru/ )

• Mikhail V. Goryachev
• Луноход1
• Отдел исследований Луны и планет

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ­ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : « , - ». Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>27) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/venturecapital_rus.pdf
• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>19577) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc3359.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc5398.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc5398.txt.pdf

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>1380) - kodomo.cmm.msu.ru/ )

• Term2
• Term1
• Term4

... Reserved Key Values . ... The following key values are reserved. An implementation is not required to interpret these key values, but if it does interpret the key value, it must provide the functionality described. { ip_port} . ... Reserved for MPI_OPEN_PORT only). { ip_address} . ... If the address is not a valid IP address of the host on which the MPI_OPEN_PORT call is made, the results are undefined. Reserved for MPI_OPEN_PORT only). ... Центры . ...

Еще в разделе: (Показать все результаты (>267) - www.parallel.ru/ )

• Reserved Keys | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Client/Server Examples | PARALLEL.RU - Информационно-аналитический центр по

PHP Manual . Prev . Next . Here is the list of PHP reserved words, usually constants and predefined variables . You won't find any functions here, but rather language constructs. You shouldn't try to use such names as variable, function, constant or method names, as it will surely lead to confusion. and . ... old_function . ... argc . ... PHP_OS . ... PHP_SELF . ... PHP_VERSION . ... function . ... HTTP_SERVER_VARS . ... list() . ... List of Function Aliases . ...

Еще в разделе: (Показать все результаты (>540) - oit.cmc.msu.ru/ )

• Servers-OmniHTTPd Server
• Servers-IIS/PWS
• Apache Virtual Host documentation

. Сontacts . Home ? User account . Create new account . Log in . Request new password (active tab) . Username or e-mail address * . Selection committee . Site map . Site search . MSU website . Contacts . Contests . Application for participation . Facebook . vKontakte . Twitter . YouTube . This site (RSS) . E -mail: info@hsmi.msu.ru . Phone: +7 495 932-80-73 . Fax: +7 495 932-80-73 . 2006-2016 MSU Higher School of Management and Innovation. All rights reserved.

Еще в разделе: (Показать все результаты (>43) - hsmi.msu.ru/ )

... This file is part of an example program for Qt. ... This example ** program may be used, distributed and modified without limitation. ** *****************************************************************************/ #ifndef BIFF _H #define BIFF _H # include qwidget.h # include qdatetime.h # include qpixmap.h class Biff : public QWidget { Q_OBJECT public: Biff ( QWidget *parent=0, const char *name=0 ); protected: void timerEvent( QTimerEvent * ); ...

Еще в разделе: (Показать все результаты (>767) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - life/life.cpp example file
• Qt Toolkit - hello/hello.cpp example file
• Qt Toolkit - aclock/aclock.cpp example file

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Продам мужские джинсы Reserved (ФОТО) . ... Re: Продам мужские джинсы Reserved (ФОТО) [ re: akim ] . ... Re: Продам мужские джинсы Reserved (ФОТО) [ re: Manager ] . ...

Еще в разделе: (Показать все результаты (>4873) - www.snto-msu.net/ )

• iostream - Public forum of MSU united student networks

The City Comet . ... Credit Copyright: Joseph M. Sivo (All Rights Reserved) Explanation: Undaunted by the artificial glow from one of the most famous urban skylines on Earth, comet Hale-Bopp shines above the city of New York, USA . ... The comet lies at a distance of about 120 million miles from New York. As bright as this comet has turned out to be, it might have been even brighter. ... NASA Web Site Statements, Warnings, and Disclaimers . NASA Official: Jay Norris. ...

Еще в разделе: (Показать все результаты (>75927) - www.astronet.ru/ )

• The City Comet
• Астронет > The City Comet
• The Keyhole Nebula

... Displays a rotating "TWiki Tip of the Day" to help familiarize new users with TWiki features. ... Initial version - Packaging by TWiki:Main.LynnwoodBrown . ... strong.tipsOfTheDayHeader - header that says "TWiki Tip of the Day" .tipsOfTheDayText - the tip; contains title and tip summary and link "Read on" .tipsOfTheDayTitle - title of the tip; the link to the tip topic . ... data/TWiki/TipsContrib.txt . ... Note: Please contribute updates to this topic on TWiki.org at TWiki:TWiki.TipsContrib . ...

Еще в разделе: (Показать все результаты (>37045) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (2 vs. 3) - TWiki
• TWikiCss - TWiki - TWiki - (printable)
• TWikiCss - TWiki - TWiki

... Certificate of State Registration of Database № 2008620382 . ... Post adress: Moscow 119991, Leninskie Gory 1, MSU, Department of Physics, chair of Quantum Electronics . ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>50) - rswater.phys.msu.ru/ )

• Лаборатория лазерной спектроскопии растворов супрамолекулярных соединений и

. Адрес: 119992, ГСП-2, Москва, Ленинские горы, МГУ, Главное здание, А-1008 . тел.: (095) 939 37 67 факс: (095) 939 02 59 . Все права на материалы, опубликованные на сайте Управления, принадлежат МГУ им.М.В. Ломоносова. При использовании материалов сайта ссылка на наши выходные данные обязательна. Просим сообщать нам о замеченных неточностях и опечатках. Webmaster . 2002-2005 УОСиП МГУ All rights reserved .

Еще в разделе: (Показать все результаты (>11) - www.edst.msu.ru/ )

• Информация

... March 26, 1997 . The City Comet . ... Explanation : Undaunted by the artificial glow from one of the most famous urban skylines on Earth, comet Hale-Bopp shines above the city of New York, USA . ... The comet lies at a distance of about 120 million miles from New York. As bright as this comet has turned out to be, it might have been even brighter. ... At that distance, Hale-Bopp might have been 100 times brighter than it is now, reaching -5th or -6th magnitude ! ... About APOD > . ...

Еще в разделе: (Показать все результаты (>11597) - www.sai.msu.su/ )

• APOD: January 12, 1998 - The Keyhole Nebula
• APOD: 2002 December 13 - The Crown of the Sun
• SAL- Programming - Tools & Utilities - PRL

... On the Institute . Status of the Institute . Institute Laboratory-Chairs . ... Library of Electronic Publications . ... Proceedings of the Institute . ... Collection of temporology screen savers . ... The Seminar program in the current semester . ... Abstracts of reports . Library of reports . Photogallery of the Seminar participants . ... 007 (495) 939-5560 . Russia, 119991, Moscow, Moscow State University, Faculty of Biology, Division of General Ecology. ...

Еще в разделе: (Показать все результаты (>1054) - chronos.msu.ru/ )

• Library of Electronic Publications

... Post Office Box 786 . ... Post Office Box 197 . ... Post Office Box 161 . ... Originally published in Russian as Sistemologiya i yazikoviye aspekti kibernetiki . ... Melnikov. G. P. [Sistemologiya i yazikovye aspekty kibernetiki. ... Systemology and linguistic aspects of cybernetics/G. P. Melnikov: . ... Studies in cybernetics; v. 16) . Translation of: Sistemologiya i vazkovye aspektv kihernetiki. ... Cybernetics. ...

Еще в разделе: (Показать все результаты (>37) - old.philol.msu.ru/ )

• HumLang - Translation System

... MySQL shareware license for Microsoft operating systems (Version 1, September 4, 1998) . ... This License applies when running MySQL on any Microsoft operating system. Microsoft operating systems include all versions of Microsoft Windows NT and Microsoft Windows. ... E-Mail: mysql-licensing@mysql.com For more about the license prices and commercial support, like email support, please refer to the MySQL manual. ... Our current policy is that a user with the MySQL license can get free upgrades. ...

Еще в разделе: (Показать все результаты (>545) - itpm.msu.su/ )

• MySQL Reference Manual for version 3.23.10-alpha. - J The MySQL server license
• Choosing the Right Maps
• mod_dumpio - Apache HTTP Server

. Обо мне . Семья . Научная деятельность . Проекты . Контакты . Портнов Иван Владимирович . Адрес ВКонтакте . Пишите на почту . Follow @coolzero_ . Официальный адрес: . 119991 , ГСП-2, . Москва, Ленинские горы, . Дом 1, строение 2, . МГУ им. М.В.Ломоносова, . Физический Факультет, . Kафедра: . физики полимеров и кристаллов, . Лаборатория: . Теории полимерных систем и "мягких" сред , . комната 2-70 . Copyright 2013 I.Portnov . All rights reserved.

Еще в разделе: (Показать все результаты (>257) - polly.phys.msu.ru/ )

• Publications
• Contacts
• Personal Page

. About the University . Application . FAQ . Electronic Resources . About the Faculty . Departments . Labs and Research Centres . Photo Archive . Please note that English & Russian versions of this site do not coinside . All rights reserved under Russian & International laws. Copyright © 1997-2011 Faculty of History, MSU. No part of this site may be reproduced electronically or otherwise without the prior written permission of the copyright owner.

Еще в разделе: (Показать все результаты (>37669) - hist.msu.ru/ )