... Modeling of separated flow in the inlet of a circular suction channel" . ... Methods for the mathematical modeling of separated flows in the inlet of a suction channel are discussed on the basis of the discrete vortex peculiarities of circular and polygonal shapes. ... Keywords: separated flows, discrete vortices, flows near a suction channel . PDF (in Russian) (541KB) . PDF. zip (in Russian) (465KB) . ...

Еще в разделе: (Показать все результаты (>539) - num-meth.srcc.msu.ru/ )

... Investigations in the field of higher fullerenes . Abstract Halogenation of higher fullerene mixtures or their perfluoroalkylation with R F I followed by HPLC separation of R F derivatives and subsequent synchrotron X-ray crystallographic study allowed one to confirm cage connectivities of higher fullerenes and, in addition, to receive information concerning their reactivity in radical addition reactions. ... Moscow University Chemistry Bulletin . 2009, Vol. ... Copyright (C) Chemistry Dept., ...

Еще в разделе: (Показать все результаты (>1627) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 45, No. 1, P. 51 (2004)
• Moscow University Chemistry Bulletin Vol. 53, No. 6, P. 369 (2012)
• Moscow University Chemistry Bulletin Vol. 53, No. 4, P. 257 (2012)

Archery simulation: Error estimation and comparison of numerical and experimental results / A. A. Luzhin. Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. 2009. ... The method proposed by the author and A.V. Zvyagin for the archery problem is verified. The method is briefly discussed. ... The numerical results are compared with experimental data. ...

Еще в разделе: (Показать все результаты (>556) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник

... The most precisely determined characteristic for accreting neutron stars (NS's) is their period. ... Period changes show fluctuations. ... Some applications of stochastic processes in astrophysics especially in accreting systems were discussed in Lipunov (1987),Hoshino Takeshima (1993) and Lipunov (1992).In Hoshino Takeshima (1993) the authors, using simple models of MHD turbulence, try to explain aperiodic changes in X-ray luminosity of X-ray pulsars. ... Here, -constant angular momentum. ...

Еще в разделе: (Показать все результаты (>446) - xray.sai.msu.ru/ )

• Frequency distribution of galactic binaries

How do Linux Threads compare with other OSs'? ... Solaris . ... Priority Scheduling [1] . ... Mutex Attributes . ... Thread Attributes . ... Posix and Solaris link thread priorities with mutexes and use the priority of a blocked thread's mutex to alter the priority of the blocking thread. Win32 and Linux let the scheduler determine what thread to elevate in priority. ... Solaris implements it because they need it: the program can change certain thread's attributes unless it is suspended. ...

Еще в разделе: (Показать все результаты (>363) - rtm-cs.sinp.msu.ru/ )

• Activation Mode Library

Электронная библиотека Попечительского совета . ... Lewis M. - Comparing, Designing, and Deploying VPHs . ... Название: Comparing, Designing, and Deploying VPHs . Автор: Lewis M. Аннотация: . ... Comparing, Designing, and Deploying VPNs will bring together many of the most popular VPN technologies for convenient reference. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10649) - lib.mexmat.ru/ )

• Carstensen B. - Comparing and predicting between several methods of measurement
• Поиск книг, содержащих Implicit separated boundary conditions :: Электронная
• Svarovsky L. - Solid-Liquid Separation :: Электронная библиотека

Nominal modification at the Syntax-Semantics Interface: comparing attributive adjectives in Italian and English In his seminal work, Bolinger (1967) discusses an asymmetry between two functions that adjectives can perform, namely attributive and predicative modification; furthermore, he points out that the syntactic asymmetry between the pre- and the post-nominal position of a number of adjectives in English is related to a semantic difference between reference- and referentmodification, respectively. ...

Еще в разделе: (Показать все результаты (>257) - www.philol.msu.ru/ )

PHP Manual . ... int dbx_compare ( array row_a, array row_b, string columnname_or_index [, int flags]) . ... This function is EXPERIMENTAL . ... Returns 0 if row_a[$columnname_or_index] is equal to row_b[$columnname_or_index], 1 if it is greater and -1 if it is smaller (or vice versa if the DBX_CMP_DESC flag is set). The flags can be set to specify comparison direction (whether sorting is ascending or descending) and comparison type (force string or numeric compare by converting the data). ...

Еще в разделе: (Показать все результаты (>724) - oit.cmc.msu.ru/ )

• version_compare
• mcal_date_compare
• ldap_compare

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>169) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services

. You can compare any two versions of a file that is under the control of SCCS with the sccsdiff command: /usr/sccs/sccsdiff -r version -r version s. filename . Using this command produces a line by line difference between the two versions of the file. Results are shown in the same format as that produced by the diff command. Examples .

Еще в разделе: (Показать все результаты (>112) - comet.sai.msu.ru/ )

• Comparing directories
• Comparing files
• Examples of comparing files with the sccsdiff command

... Shortly after its discovery it was determined to be in a highly elliptical path near Jupiter and on a collision course. ... The size and mass of the original body and the individual fragments is as of this writing still highly uncertain. ... Between 16 July 1994 and 22 July 1994 the fragments impacted the upper atmosphere of Jupiter. ... The pictures were posted to the Net within hours of the impacts and caused severe overloading on some ftp and WWW sites. ... JPL's SL9 page . ... Small Bodies .. ...

Еще в разделе: (Показать все результаты (>4960) - www.sai.msu.su/ )

• SAL- Programming - Languages Compilers - Objective Caml (OCaml)
• APOD: 2011 February 3 - Six Worlds for Kepler-11
• APOD: 2007 August 20 - Cluster Crash Illuminates Dark Matter Conundrum

... Measurement of B-type natriuretic peptide by two assays utilizing antibodies with different epitope specificity. ... DESIGN AND METHODS: Plasma samples (n=94) from HF patients were analyzed by the novel-type "Single Epitope Sandwich" (SES assay prototype) and the conventional-type Siemens ADVIA Centaur BNP assays. ... RESULTS: The SES assay measured 1.2- to 7.2-fold (2.1+/-0.9; mean, SD) greater BNP concentrations compared to the Siemens assay. ...

Еще в разделе: (Показать все результаты (>49) - biochem.bio.msu.ru/ )

... The goal of our work was to study the particularities of the flower behavior of Nymphaea candida L. To reach this goal we marked these problems: . 1)To study the dynamics of the behavior of Nymphaea candida flowers. 2)To find the factors which cause the rhythmic behavior of the flowers and intensity of the bloom of Nymphaea candida . ... 4)To compare published material on biological rhythms of different plant species with our material on the behavior of Nymphaea candida flowers. ...

Еще в разделе: (Показать все результаты (>160) - herba.msu.ru/ )

... Ivanovo State University . My experience as a Fulbright scholar in the USA gave me an ample opportunity to compare the structure, functions and modes of self-identification in the US and Russian academic communities. Overall, the American university system seemed more flexible and capable of self-adjusting to the demands of the moment. ... Though Russia is far behind the USA in technology and electronic media, we still can adopt some American educational technologies. ...

Еще в разделе: (Показать все результаты (>95) - www.prof.msu.ru/ )

... Thorough Testing . ... The examples/test directory contains subdirectories of small programs that systematically test a large subset of the MPI functions. ... make testing in the mpich/examples/test directory will cause these programs to be compiled, linked, executed, and their output to be compared with the expected output. ... make clean in the test directory afterwards. ... make testing in the separate subdirectories for examples/test . ... Центры . ...

Еще в разделе: (Показать все результаты (>291) - www.parallel.ru/ )

• MPI_Comm_compare | PARALLEL.RU - Информационно-аналитический центр по
• MPI_Group_compare | PARALLEL.RU - Информационно-аналитический центр по
• C++ Bindings for Groups, Contexts, and Communicators | PARALLEL.RU -

. Album : asv-album :: Travels to distant places and countries :: 1997/08 Kyoto, Nara (Japan) :: 20/08 Nijo castle (ancient shogun palace). Assembly opening. Maiko . Up . Nijo castle, Shogun palace. The main building. Comparing to temples and shrines, royal architecture looks modest. Next >> . Photo album generated by album generator from Marginal Hacks by David Madison on Tue Jun 23 14:46:11 2015 .

Еще в разделе: (Показать все результаты (>4287) - crydee.sai.msu.ru/ )

• Publications
• Long description of example illustrating the separated borders model

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . ... Войти в систему . ... Создать обращение в службу поддержки пользователей . ...

Еще в разделе: (Показать все результаты (>3526) - istina.msu.ru/ )

• Journal of Separation Science - журнал | ИСТИНА - Интеллектуальная Система
• Separation and Purification Technology - журнал | ИСТИНА - Интеллектуальная
• Penner N. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... The following diets will be discussed: . ... michael kors outlet uk . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key ...

Еще в разделе: (Показать все результаты (>40) - elana.sinp.msu.ru/ )

• cheap north face Gildan Activewear?s CEO Discusses Q2 2012 Results | С Днем

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: compare administrative billion perfumes p . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>3115) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: tax of goods compared that
• Экологический Форум - Фундаментальная Экология: Compare Best Prices
• Экологический Форум - Фундаментальная Экология: than or previous compare use

The idea of stratified sampling method is to divide a volume of integration into a large number of sub-volumes and calculate integrals separately in each sub-volume. This method produces a smaller uncertainty comparing with the direct Monte Carlo method because here the uncertainty is caused only by a function variance in the sub-volumes, while the integrand variation from one sub-volume to another does not contribute to the uncertainty. ...

Еще в разделе: (Показать все результаты (>537) - theory.sinp.msu.ru/ )