... О UNИX . ... 09_Addressing . Неизменяемая страница . ... 1 ## poly.asm -- complete program 2 ## 3 ## evaluate 5 x ^ 2 - 12 x + 97 4 ## 5 ## Register Use : 6 ## 7 ## $10 base register , address of x 8 ## $11 x 9 ## $12 value of the polynomial 10 ## $13 temporary 11 12 .text 13 .globl main 14 15 main : 16 lui $ 10 , 0x1001 # Init base register 17 lw $ 11 , 0 ( $ 10 ) # Load x 18 19 ori $ 12 , $ 0 , 97 # Initialize the accumulator 20 # during the load delay slot 21 22 ...

Еще в разделе: (Показать все результаты (>11) - uneex.mithril.cs.msu.su/ )

... unknown) sesam_fetch_result -- Return all or part of a query result . mixed sesam_fetch_result ( string result_id [, int max_rows]) . Returns a mixed array with the query result entries, optionally limited to a maximum of max_rows rows. ... int $arr["rows"] . number of rows in result set (between zero and max_rows ) . ... result data for all the fields at row( row ) and column( col ), (where the integer index row is between 0 and $arr["rows"]-1 , and col is between 0 and $arr["count"]-1 ). ...

Еще в разделе: (Показать все результаты (>1170) - oit.cmc.msu.ru/ )

• sesam_field_array
• ldap_get_values
• ldap_get_entries

... Численное треугольное разложение симметричной положительно определенной разреженной матрицы, заданной в формате RR (U) U. Описания форматов RR (U) U и RR (U) О приведены в описаниях подпрограмм AM21R и ASH4R соответственно. ... Технология разреженных матриц. ... численное треугольное разложение симметричной положительно определенной разреженной матрицы, заданной в формате RR (U) U, в режиме расширенной (Extended) точности; при этом параметры AN, AD, UN и DI должны имет тип Extended. ...

Еще в разделе: (Показать все результаты (>1533) - num-anal.srcc.msu.ru/ )

• БЧА НИВЦ МГУ. MLC6R_P. Задача целочисленного линейного программирования
• БЧА НИВЦ МГУ. ML05R_P. Общая задача линейного программирования
• БЧА НИВЦ МГУ. MNB6R_P. Задача безусловной минимизации функции многих переменных

... A meta-data object is a hash of different types of meta-data (keyed on the type, such as 'FIELD' and 'TOPICINFO'). Each entry in the hash is an array, where each entry in the array contains another hash of the key=value pairs, corresponding to a single meta-datum. ... The array entries are keyed with the attribute 'name' which must be in each entry in the array. ... put ObjectMethod put ($type,\%args) . ... get ObjectMethod get ($type,$key) -> \%hash . ... remove ObjectMethod remove ($type,$key) . ...

Еще в разделе: (Показать все результаты (>36933) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% ( vs. 1) - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki
• TWikiInfixNodeDotPm - TWiki - TWiki - (printable)

The English word "array" is translated into Swedish as "f lt" which is retranslated into English as "field". We may therefore perhaps use the word field either by mistake or as a suitable name of a specific array. A new feature of Fortran 90 is that you can work directly with a whole array or an array section without explicit (or implicit) DO -loops. ... An array is defined to have a shape given by its number of dimensions (called " rank ") and the extent for each one of these. ...

Еще в разделе: (Показать все результаты (>2306) - crydee.sai.msu.ru/ )

• Recursion

... GET["from_year"]; $condition .= FILE_DATE > '$SEARCH_FILE_DATE_FROM'"; } if( $_GET["to_day"] $_GET["to_month"] $_GET["to_year"] ) { if( $condition ) { $condition .= ... KD_SQUARE $page_end ) { continue; } $FD = oci_result($stmt, 1); $KD_SQUARE = oci_result($stmt, 2); $IMG_INTEN = oci_result($stmt, 3); # $KD_INTEN = oci_result($stmt, 3); $KD_NUM = oci_result($stmt, "KD_NUM"); $LAMB = oci_result($stmt, "LAMB"); $INST = oci_result($stmt, "INST"); $KEY = oci_result($stmt, "KEY"); $FILE_DATE = $FD{0}.$ ...

Еще в разделе: (Показать все результаты (>4) - dbserv.sinp.msu.ru/ )

• Publications

... Arrays are handled somewhat awkwardly in CORBA. ... If the array element is a string or an object reference, then the mapping uses the same type as for structure members. ... Besides the Array_forany mapping the CORBA standard also describes a mapping for an array slice . ... Output parameters and results are handled via pointers to array slices. ... SS_slice* bar( const SS ss1, SS ss2, SS_slice*& ss3, long_arr arr ) { //... ss3 = SS_alloc(); SS_slice *res = SS_alloc(); return res; }; }; . ...

Еще в разделе: (Показать все результаты (>544) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QBitArray Class
• Unions
• A CGI-Based C Server

For separation of anisotropy and inhomogeneity influence we recommend non-symmetrical rotation of arrays (for example, to rotate the D - array around the center of AB (or MN), instead of spacing center) and analysis of azimuthal diagrams' spectrum (Bolshakov et al., ... Dipole equatorial array is not so convenient for asymmetrical rotation, at which one dipole is gone along a circle’s arch, while other dipole turns around its center. ...

Еще в разделе: (Показать все результаты (>79) - geophys.geol.msu.ru/ )

• TES. C-effect
• TRF_2d. Page 4.
• Page 2

... 1 import base . ... 4 """A dictionary of default markup name -> markup class.""" . ... 6 def update ( * args ): . ... values (): . ... 66 def to_record ( self , keys = None ): . ... 74 markup = self . ... 136 def parse_item ( self , key , value ): . ... 139 def repr_item ( self , key , value ): . ... 143 """Generic class for string-based markups.""" . ... 167 for number , monomer in enumerate ( self . ... 179 """Generic class for string-based markups.""" . ... 229 def parse_item ( monomer , value ):...

Еще в разделе: (Показать все результаты (>111666) - kodomo.fbb.msu.ru/ )

• allpy: f780b7ba75c6 allpy/dna.py
• allpy: allpy/dna.py annotate
• allpy: 8c42f9daa527 sandbox/ttk.py

... METHOD . ... public interface IndexMap . ... The int [] transform(int [] output, int [] input) does this. ... The transformation of values in the input array is obtained by calling int [] getTransformed(int [] output) . ... int[] . ... input - int array domain reference member. public int[] getTransformed (int[] output) . ... public int[] transform (int[] output, int[] input) . ... lengths - int array representing the shape on the forward transform output. public int[] getLengths (int[] output) . ...

Еще в разделе: (Показать все результаты (>54) - angel.cs.msu.su/ )

• : Class ConcreteIndexMap
• : Interface Accessor
• Appendix B File Format Specification

Subcadr Pirsum ( In : A,K) : Integer ; . Var A: Array Integer [N: Vector ] Com ; . Var C: Array Integer [N/2: Vector , N/2: Vector ] Com ; . Var T,L: Integer Reg ; . Var M: Integer Com ; . Var I,J: Number ; . ... Begin ; . ... End ; . ... C[J,I]=C[J-1, I]+C[J-1, I-L/2]; . ... Endsubcadr ; . ...

Еще в разделе: (Показать все результаты (>10) - colamo.parallel.ru/ )

Электронная библиотека Попечительского совета . ... Maple 8. Learning guide . ... Название: Maple 8. ... Advanced Programming Guide 3 . ... Base n numbers, converting to 13 . ... Binary numbers, converting to 13 . ... CONVERT 34 270 . Convert, base 13 . Convert, binary 13 . Convert, exp 34 162 . Convert, factorial 162 . Convert, hex 13 . Convert, list 34 190 271 . Convert, ln 162 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>11430) - lib.mexmat.ru/ )

• Liberty J. - Learning Visual Basic .NET :: Электронная библиотека
• Liberty J., MacDonald B. - Learning C# 2005 :: Электронная библиотека
• Diaz J. (ed.), Ramos I. (ed.) - Formalization of Programming Concepts ::

The Department of Talented Youth Affairs and Professional Orientation . ... International Biological Universiade . ... November 22, 2015 the International Biological Universiade was closed at Lomonosov Moscow State University. The Universiade is aimed at the expansion of educational space. ... In 2015 the V International Biological Universiade was attended by 46 teams. ... The Universiade was held in two rounds. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>145) - talant.msu.ru/ )

• Results of the 48th Mendeleev International Olympiad in Chemistry | The

arxiv:1502.00612 Совместный анализ данных BICEP2/Keck Array и Planck (A Joint Analysis of BICEP2/Keck Array and Planck Data) . Authors:BICEP2/Keck, Planck Collaborations . arxiv:1502.01582 Результаты Планка 2015: I. Обзор данных и научных результатов (Planck 2015 results. ... Authors: Planck Collaboration . ... Authors: Giovanni Carraro . ... arxiv:1502.01323 Обсерватория космических лучей имени Пьера Оже (The Pierre Auger Cosmic Ray Observatory) . Authors: The Pierre Auger Collaboration . ...

Еще в разделе: (Показать все результаты (>272) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/1103.html

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ...

Еще в разделе: (Показать все результаты (>1509) - istina.msu.ru/ )

• Chiavassa A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Navarra G. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Br?ckner - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

DVM debugger - contents . Part 1 (1 - 4) . ... Writing to read-only variable is detected. ... Using non-initialized element <elem> . ... Using variable <var> before asynchronous reduction competed . ... The dynamic debugger detects access to a shadow element before asynchronous shadow renew competed . ... It is reported when any non-correspondence of trace or loop description file is detected. ... Different values of reduction operation are detected for current event and in reference trace record. ...

Еще в разделе: (Показать все результаты (>148) - sp.cs.msu.ru/ )

• Lib-DVM. Interface description
• Lib-DVM. Preliminary design
• DVM debugger. Detailed design

Query [NEEDLEP-JobName:temp_job2] found 1 entries . Apply Options to: . ... Result Options . ... Link to related information: . ... View results using: . ... Aligned_sequences: 2 # 1: PYRD_HUMAN # 2: PYRD_METJA # Matrix: EBLOSUM62 # Gap_penalty: 10.0 # Extend_penalty: 0.5 # # Length: 311 # Identity: 90/311 (28.9%) # Similarity: 156/311 (50.2%) # Gaps: 35/311 (11.3%) # Score: 288.5 # # #======================================= PYRD_HUMAN 1 MLEVRVLGHKFRNPVGIAAG-FDKHGEAVDGLYKMGFGFVEIGSVTPKPQ 49 || ...

Еще в разделе: (Показать все результаты (>4302) - kodomo.cmm.msu.ru/ )

... Interference of Two Co-Generated Frequency Modulated Parametric Array Signals . ... These effects include the interference of the output of the matchfilters of the difference frequency signals of two parametric arrays generated simultaneously by the same transducer. a) One of the two parametric arrays is forward linear frequency modulated ; the other is backward linear frequency modulated , and the central frequencies of the modulating signals for the two parametric ...

Еще в разделе: (Показать все результаты (>286) - acs366.phys.msu.su/ )

• Abstract (Invited)

On problem of interpretation and forecasting space-temporary variations of geophysical fields on results of deep scientific drilling Esipko O.A., Kolbasova A.V., Rosaev A.E. In the process of boring the deep bore holes, as scientific, so and industrial one's living, and when processing the received results, the problem of large arrays of data analyses appears. ... The example of geophysical data development As an example of with depth and variation log data with 0.2 meters of (verified) data. ...

Еще в разделе: (Показать все результаты (>57) - acat02.sinp.msu.ru/ )

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>16) - comphep.sinp.msu.ru/ )