... Jorma Joutsensaari - Aerosol synthesis of nanostructured, ultrafine fullerene particles . ... Название: Aerosol synthesis of nanostructured, ultrafine fullerene particles . Автор: Jorma Joutsensaari . ... Aerosol synthesis methods for the production of nanostractured fullerene particles have been developed. The nanostractured, ultrafine fullerene particles were produced by vapor condensation and aerosol droplet drying and crystallization methods in tubular laminar flow reactors. ...

Еще в разделе: (Показать все результаты (>1377) - lib.mexmat.ru/ )

• Rodriguez J.A. - Synthesis, Properties, and Applications of Oxide Nanomaterials
• Vardanyan R.S., Hruby V.J. - Synthesis of Essential Drugs :: Электронная
• Поиск книг, содержащих chemical synthesis, of $C^{60}$ :: Электронная

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Издательство: Georg Thieme Verlag . ... Makukhin N.N. , Goulioukina N.S. , Bessmertnykh-Lemeune A.G. , Brand?s S. , Guilard R.r. , Beletskaya I.P. в журнале Synthesis , издательство Georg Thieme Verlag (Germany) , том 47, ? ... в журнале Synthesis , издательство Georg Thieme Verlag (Germany) , том 44, ? ...

Еще в разделе: (Показать все результаты (>2664) - istina.msu.ru/ )

• Advanced Synthesis and Catalysis - журнал | ИСТИНА - Интеллектуальная Система
• SYNTHESIS-STUTTGART - журнал | ИСТИНА - Интеллектуальная Система Тематического
• Current Organic Synthesis - журнал | ИСТИНА - Интеллектуальная Система

... About/history Contacts Administration Education Staff . Laboratories: . Inorganic Materials Sciences . Chemistry of Coordination Compounds . Chemistry and Physics of Sensor and Semiconductor Materials . Inorganic Synthesis . ... Russian . Founded in 1953 by Prof. A.V.Novoselova . ... Phone: Office +7(495)939-3339 . ... Address: Inorganic Synthesis Laboratory , Chemistry Department , Lomonosov Moscow State University , Leninskie Gory 1-3, Moscow 119991, Russia . ...

Еще в разделе: (Показать все результаты (>168) - www.inorg.chem.msu.ru/ )

• Group of Hydrothermal Synthesis :: Scientific Interests
• Group of Hydrothermal Synthesis :: Anton I. Gavrilov
• Group of Hydrothermal Synthesis :: Main

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Детализация рейтинга: SynThesis . ... Common . ... msu . ... SynThesis . ...

Еще в разделе: (Показать все результаты (>357) - www.fds-net.ru/ )

• Персональная информация о SynThesis - Public forum of MSU united student
• User stats: SynThesis - Public forum of MSU united student networks
• Re: Закрытие сезона - Public forum of MSU united student networks

... About lab . ... Selected publications . Publications . ... Courses . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . Educational courses (in russian) . ... An Approach to Cloth Synthesis and Visualization. Publication Type . Conference Paper . Year of Publication . ... Conference Name . ... Publication Language . ...

Еще в разделе: (Показать все результаты (>13) - graphics.cs.msu.ru/ )

• Image Registration: Color Image Synthesis from Data Obtained from Satellites
• An Approach to Cloth Synthesis and Visualization. | Лаборатория компьютерной

of the division of INORGANIC CHEMISTRY . Boris A. Popovkin , Professor, Dr.Sci. - head of the laboratory since 1987 . The Laboratory was founded in 1953 by Academician A.V. Novoselova. ... Vladimir A. Alyoshin, Ph.D., Associate Professor . Elena I. Ardashnikova, Ph.D., Associate Professor . ... Professor . ... The principles of inorganic synthesis (Prof. B.A. Popovkin). Soft and selective synthesis of some inorganic substances (Prof. B.A. Popovkin, Leading Scientist V.A. Dolgikh). ...

Еще в разделе: (Показать все результаты (>558) - chem.msu.ru/ )

• Synthesis and study of the h.c.p. phase of Buckminsterfullerene
• Laboratory of organic synthesis
• Synthesis and Characterisation of 1-[9-(H, Me3Si, Me3Ge, Me3Sn)-9-Fluorenyl]-

. Home . Research Focus . Lab Members . Publications . Protocols . Contacts . Русский .

Еще в разделе: (Показать все результаты (>85) - www.genebee.msu.ru/ )

• Лаборатория регуляции белкового синтеза

Next: The Model Up: No Title Previous: Radiopulsars as Sources of . In this section, we study the evolution of stellar populations on a time-scale of 10 Myr for a starburst љ occurring under conditions similar to those in the Galactic Center (see Lipunov et al. (1995d)[ 126 ]). We estimate the expected number of X-ray transient љ sources (NS + MS star), super accreting BH, and BH + supergiant binaries, all as functions of time elapsed after the burst. ...

Еще в разделе: (Показать все результаты (>104) - xray.sai.msu.ru/ )

• Population synthesis of X-ray sources at the Galactic center
• No Title
• Introduction

... A problem of synthesis of nano-optical elements for the formation of dynamic images" . Goncharsky A.A., Durlevich S.R. The inverse problems of synthesis of nano-optical elements for the formation of dynamic images that change their position as the flat optical element is tilted are considered. The inverse problem of computing the microrelief of nano-optical elements is solved in the framework of the Fresnel scalar wave model. ...

Еще в разделе: (Показать все результаты (>32) - num-meth.srcc.msu.ru/ )

• On a problem of the synthesis of nano-optical protection elements
• "On the problem of synthesis of nano-optical elements"
• "A synthesis of simplex and linear correction methods for linear optimization

P. Frick, D.Sokoloff, R. Stepanov, R. Beck)Faraday rotation measure synthesis for magnetic fields of galaxies, MNRAS, {\bf 414}, N3, 2540 - 2549, 2011 . ... Here we consider how to apply RM synthesis to reconstruct the Faraday dispersion function, aiming at the further extraction of information concerning the magnetic fields of extended sources, for example galaxies. ... We describe the contribution of small-scale fields in terms of Faraday dispersion and beam depolarization. ...

Еще в разделе: (Показать все результаты (>23) - srcc.msu.ru/ )

• V. Pervak, M.K. Trubetskov, A.V. Tikhonravov, Robust synthesis of dispersive
• Michael K. Trubetskov and Alexander V. Tikhonravov. Robust synthesis of
• Beck R., Frick P., Stepanov, R., Sokoloff D. Recognizing magnetic structures by

... SYNTHESIS OF ZIEGLER-NATTA CATALYSTS SUPPORTED ON SOL-GEL MATERIAL AND ITS APPLICATION IN GAS-PHASE AND SLURRY POLYMERIZATION OF ETHYLENE . ... Heterogenization allows regulating polymer morphology as well. ... Our earlier results showed that new silica-type material obtained in sol-gel process may be successfully used as a support of organometallic catalysts for ethylene polymerization [1-4]. ... activity of supported Ziegler-Natta catalysts in gas-phase and slurry polymerization. ...

Еще в разделе: (Показать все результаты (>140) - www.chem.msu.ru/ )

• Лаборатория химии поверхности - ПУБЛИКАЦИИ ПОСЛЕДНИХ ЛЕТ

Tetrahedron: Asymmetry . ... Synthesis of chiral -lactones in a two-enzyme system of cyclohexanone mono-oxygenase and formate dehydrogenase with integrated bubble-free aeration . ... A two-enzyme system consisting of a cyclohexanone mono-oxygenase from Acinetobacter NCIMB 9871 and a protein-engineered formate dehydrogenase for the regeneration of the cofactor NADPH was used for the synthesis of chiral -lactones. ...

Еще в разделе: (Показать все результаты (>53) - www.enzyme.chem.msu.ru/ )

• Abstract

.

Еще в разделе: (Показать все результаты (>148) - www.chemport.ru/ )

• Титан треххлористый, 15%-ный р-р, for synthesis, (мелкая уп.) -
• Бор треххлористый, for synthesis, (мелкая уп.) - компании-поставщики этого
• Хлорсульфоновая кислота, for synthesis, (мелкая уп.) - компании-поставщики

Back to homepage >> . Trusov S.V., Pletchov P.Yu. and Kotelnikov A.R. The aim of this work was a melt inclusion synthesis during the process of new phase growth on natural crystals of similar composition. ... Such effect is observed at feldspar crystallization on the inclusion walls. ... It allows one to observe the evolution of melt composition by the study of melt inclusion compositions in the different newly- formed zones. ...

Еще в разделе: (Показать все результаты (>52) - geo.web.ru/ )

BIOH _CITK8 A8AQW5 RecName : Full = Carboxylesterase bioH ; EC= 3.1.1.1 ; AltName : Full = Biotin synthesis protein bioH ; M-NDIWWQTEGQGNCHLVLLHGWGLNAEVWNCIRE-ELSAHFTLHLVDLPGFGRS-- QGF GAMSLEQMAKHVLKQAPDKAVWLGWSLGGLVASQVALTHPERVQALVTVASSPCFSAREA WP-GIKPDILAGFQQQLSEDFQRTVERFLALQTLGTETARQDARTLKSAVLALPMPEVAV LNGGLEILKTADLREPLKSLTMPFLRLYGYLDGLVPRKVVPMLDAA ...

Еще в разделе: (Показать все результаты (>102) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~lu.andreeva/my_aligned.fasta
• http://kodomo.cmm.msu.ru/~lu.andreeva/myproteins_aligned.fasta
• PubMed

Davydova, N.K. Synthesis and reactions of 3-nitro-4-oxo-1,4-dihydroquinolines.- ... L'vov, A.I., Sizova, O.S., Davydova, N.K., Glushkov, R.G. New process for the synthesis of antiatherosclerotic drug gemfibrozil.- ... Glushkov, R.G., L'vov, A.I., Sizova, O.S., Davydova, N.K., Sanzharova, G.M., Polyakova, M.Ya., ... Glushkov, R.G., L'vov, A.I., Sizova, O.S., Davydova, N.K., Balashova, I.A., Solov'eva, N.P., Anisimova, O.S. Use of the Koch-Haaf's Reaction in the new synthesis of gemfibrozil. ...

Еще в разделе: (Показать все результаты (>175) - polly.phys.msu.ru/ )

• Selected publications of Blagodatskikh, Inesa Vasilievna
• New Methods of Organosilicon Chemistry - Chair of Polymer and Crystal Physics
• Selected publications of Keshtov, Mukhamed Lostanbievich

... 2004 год . 1) Goryunkov A.A., Ioffe I.N., Kuvychko I.V., Yankova T.S., Markov V.Y., Streletskii A.V., Dick D.L., Sidorov L.N., Trifluoromethylated [60]fullerenes: synthesis and characterization. Fullerenes, Nanotubes, and Carbon Nanostructures , 2004, v. 12, 181-185. ... 3) Denisenko N.I., Troyanov S.I., Popov A.A., Kuvychko I.V., Zemva B., Kemnitz E., Strauss S.H., Boltalina O.V., T h -C 60 F 24 , J. Am. ... Copyright 2006-2012, Лаборатория термохимии, Московский государственный университет . ...

Еще в разделе: (Показать все результаты (>32) - thermolab.chem.msu.ru/ )

... Head of the Department of Emission-line Stars and Galaxies of SAI MSU . ... Structure and kinematics of galaxies . ... Strasburg Database . Hubble Telescope Archive . ... CFHT Archive . ... Chinese evolutionary synthesis Yunnan . Korean evolutionary synthesis Yonsei . Evolutionary synthesis database BaSTI . ... Electronic Journal "New Astronomy" . Electronic Astrophysical Journal . Electronic Astronomical Journal . ... Questions and comments send to Olga Sil'chenko olga@sai.msu.su ...

Еще в разделе: (Показать все результаты (>23) - sn.sai.msu.ru/ )

... Composing of New Materials Using the Method of Self-Propagating High-Temperature Synthesis in Presence of Ultrasonic Vibrations . ... One of the promising techniques of the manufacture of new materials with a wide complex of various properties is the method of self-propagating high-temperature synthesis (SHS). The essence of the SHS method lies in conducting the process in the regime of combustion due to exothermal reaction of components without the use of considerable external heating. ...

Еще в разделе: (Показать все результаты (>8) - acs366.phys.msu.su/ )

• AUTHOR : Klubovich V
• AUTHOR : Kulak M

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Hobby >> Media >> Re: Закрытие сезона . ... Рейтинг: 8009 . Re: Закрытие сезона [ re: mcombo ] . ... SynThesis . ... Рейтинг: 336 . ... Re: Закрытие сезона [ re: SynThesis ] . ...

Еще в разделе: (Показать все результаты (>228) - www.snto-msu.net/ )

• Re: Интервью с Шахназаровым - Public forum of MSU united student networks
• Звонки с подавленного номера - ситуация - Public forum of MSU united student
• подскажите, что за фильм про турков в германии - Public forum of MSU united