Электронная библиотека Попечительского совета . ... Mejlbro L. - Calculus 1c-3, Examples of Integrals . ... Название: Calculus 1c-3, Examples of Integrals . Автор: Mejlbro L. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>11952) - lib.mexmat.ru/ )

• Mejlbro L. - Calculus 2c-6, Examples of Space Integrals :: Электронная
• Mejlbro L. - Calculus 2c-5, Examples of Plane Integrals :: Электронная
• Mejlbro L. - Calculus 2c-8, Examples of Surface Integrals :: Электронная

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > И?Ет . ... example_module . ... РЬ Й?М-ДТ ОЦЦФФЕ Р?М-Й? 2.0 Й?Р?ПЕМ- К?АцЕШ ГЛПыРЛ ДуАэ РжС? ... ОЦЦФФЕ ЙшЦ?КЛ src/modules/example Е?ЗКХфИ? ... И?ЕтРЛ РлМКЧЯЗСДТ ЛчЖ?ЕщРЛ ЕНБтР?Чб ПЙС?Дй. mod_example.c ДТ И?Еч ФнЙщ(callback) БИСЖПЭ Ш?Ут Й?ЙРЛ МГИэЧЯДТ ЦФРЯРЬДй. ... Example . ... mod_example И?Ет ЛчПыЧЯБт . ... src/Configuration ЦФРЯ ОЦЗЕ КЮКаПЕ РжДТ "AddModule modules/example/mod_example" СйРЧ СжМ?УГИ?И? О?ОиДй. ...

Еще в разделе: (Показать все результаты (>425) - itpm.msu.su/ )

• Another Example
• Examples
• An Example sendmail.m4 File

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>93) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache's Handler Use

This module is contained in the modules/mod_example.c file, and is not compiled in by default. It illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... cp src/modules/example/* src/modules/ mymodule . ... Example . ...

Еще в разделе: (Показать все результаты (>555) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - trivial/trivial.cpp example file
• Qt Toolkit - progress/progress.cpp example file
• Running the example

... In this first example, we allow an object to fall onto a small radar unit . The resulting Time-Frequency distribution is shown as a contour plot in Fig. 8 (a). Figure: FIGURE GOES SOMEWHERE IN THIS GENERAL VICINITY . ... Its density plot appears as an image in Fig. ... The response has a very high peak, as evidenced from Fig. ...

Еще в разделе: (Показать все результаты (>856) - crydee.sai.msu.ru/ )

• Long description for example showing how structurally overlapping cells are
• One example
• Long description for the second Bach/XML formatting example

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>52) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.

To print commands and their arguments as they are executed: cat example #!/bin/sh TEST1=result1 TEST2=result2 if [ $TEST1 = "result2" ] then echo $TEST1 fi if [ $TEST1 = "result1" ] then echo $TEST1 fi if [ $test3 = "whosit" ] then echo fail here cos it's wrong fi . This is a script called example which has an error in it; the variable $test3 is not set so the 3rd and last test [ command will fail. Running the script produces: example result1 [: argument expected . ...

Еще в разделе: (Показать все результаты (>473) - comet.sai.msu.ru/ )

• Example of how mail is displayed
• Examples of using the diff command
• Examples of using the sort command

... fc3:dokuwiki:example ]] . THEP . ... Note: The Dokuwiki to be upgraded is in /var/www/wiki on the machine called mybox, I am logged in as root, and Dokuwiki version 2005-07-01 has been extracted to ~/dokuwiki/wiki/ . ... Create a temp directory mybox:/var/www# mkdir newwiki . ... Copy the changes.log file to the new location mybox:/var/www/newwiki# cp .. / wiki / changes.log data / . Copy standard data to the new location mybox:/var/www/newwiki# cp -R .. / wiki / data /* data / pages / . ...

Еще в разделе: (Показать все результаты (>687) - theory.sinp.msu.ru/ )

• Example: Summation of diagrams and symbolic integration by means of the Reduce
• Examples

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1356) - kodomo.cmm.msu.ru/ )

• examples.zip тАУ Cyclyc Cell Automata
• WikiRestructuredText тАУ Tanchiki

... Use the %INCLUDE{...}% variable to embed the content of another topic or web page inside a TWiki topic. ... Include a topic MyTopic with two parameters . ... INCLUDE{ "page" pattern="reg-exp" rev="2" warn="off" section="clients" PARAMETER1="value" PARAMETER2="Some value"}% . ... The example parameters PARAMETER1 and PARAMETER2 will be defined as a variable within the scope of the included topic. ... You include the topic with this line %INCLUDE{ "MyTopic" BETTER="apples" WORSE="Oranges"}% . ...

Еще в разделе: (Показать все результаты (>39843) - dualopt1.cmm.msu.ru/ )

• IncludeTopicsAndWebPages - TWiki - TWiki - (printable)
• %TOPICTITLE% (5 vs. 6) - TWiki

... This program was created for correlating chosen regions in the series of fts images. ... Chosen regions' . ... In this section the program counts the integral for each region of the grid for each image. ... As a matter of fact, the integral is total brightness of the region and it is counted by 'int_tabulated' IDL function. ... In addition, the program will show the count of the regions which correlate with the corresponding region (the brighter region means the bigger count) and its contour. ...

Еще в разделе: (Показать все результаты (>115) - lnfm1.sai.msu.ru/ )

• Calibration data
• Manpage of FITSHDR

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>133) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• Input Formats

. Name . Last modified . Size . Description . Parent Directory . - . alpha/ . 2007-02-10 22:19 . - . alpha_and_beta/ . 2007-02-10 22:19 . - . beta/ . 2007-02-10 22:19 . - . Apache/2.4.12 (Debian) Server at kodomo.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>5597) - kodomo.fbb.msu.ru/ )

• snake: 954cc2774637 snakes/example.snake
• cca: a308291203ea state.py
• cca: a308291203ea .hgtags

... General Contraction (GC) i=j cijxkylzmexp(-jr2) common set of exponents within each shell type (very) long expansions Examples: Roos' ANO, Dunning's cc-pVXZ (to some degree) Standard Direct Fock matrix formation code loop over all shells (P index) loop over Q P, Q in P domain loop over all shells (R index) · loop over S R, S in R domain Check (PQ|RS) using selection criterion Calculate non-negligible (PQ|RS) if any Add their contributions ...

Еще в разделе: (Показать все результаты (>77) - classic.chem.msu.su/ )

• http://classic.chem.msu.su/gran/gamess/qdpt2.pdf
• Lesson 3: two methods for preparing Firefly' input files with basis sets and
• Potential Energy Surfaces with PC GAMESS/Firefly

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>85) - hist.msu.ru/ )

... About lab . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for recovering visual quality of video ripped from DVD (for example, when it contains 4 hours of video data), VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc. The algorithm decreases blocking artifacts, significantly improving visual quality of video. Filter automatically determines the blockiness's strength on the frame and in the certain part of it, preserving the maximum of details. ...

Еще в разделе: (Показать все результаты (>205) - graphics.cs.msu.ru/ )

• Removing of blocking effect from video | Лаборатория компьютерной графики и
• High-quality increase of video color depth | Graphics and Media Lab
• High-quality increase of video color depth | Лаборатория компьютерной графики и

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>218) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round